KEGG   Sphingomonas wittichii: Swit_1771Help
Entry
Swit_1771         CDS       T00538                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swi  Sphingomonas wittichii
Pathway
swi00071  Fatty acid degradation
swi00072  Synthesis and degradation of ketone bodies
swi00280  Valine, leucine and isoleucine degradation
swi00310  Lysine degradation
swi00362  Benzoate degradation
swi00380  Tryptophan metabolism
swi00620  Pyruvate metabolism
swi00630  Glyoxylate and dicarboxylate metabolism
swi00640  Propanoate metabolism
swi00650  Butanoate metabolism
swi00900  Terpenoid backbone biosynthesis
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
swi01212  Fatty acid metabolism
swi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swit_1771
   00630 Glyoxylate and dicarboxylate metabolism
    Swit_1771
   00640 Propanoate metabolism
    Swit_1771
   00650 Butanoate metabolism
    Swit_1771
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Swit_1771
   00072 Synthesis and degradation of ketone bodies
    Swit_1771
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swit_1771
   00310 Lysine degradation
    Swit_1771
   00380 Tryptophan metabolism
    Swit_1771
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Swit_1771
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swit_1771
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Swit_1771
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swi04147]
    Swit_1771
Enzymes [BR:swi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Swit_1771
Exosome [BR:swi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swit_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABQ68133
UniProt: A5V767
Position
complement(1980885..1982138)
Genome map
AA seq 417 aa AA seqDB search
MPEAYIIDAVRTPRGIGKTGKGALAHLHPQQLAASVLKALRERNGFDTADVDDIIWSTSM
QRGTQGGDLGRMAALDAGYDVRASGVTLDRYCGGGITAVSLAAAQIMAGMEDLLIAGGSE
MMSLTATLSQQEAAAGLPVYGIGSGNDRLQAVHPQSHQGVCGDAIAALEGIGREELDAAG
LESQRRADRAIREGRFARSLVPVVDDEGRVLLDADEYPRPQTTAEGLAQLKPAFEALART
PIDETGTTYAGLINRKFPDLDIRPVHHAGNSSGVVDGAAALLLASKDYAERHGLKPRARI
VATANVGDDPTLMLNAPVPAARKALKKAGLTKDDIDLWEINEAFAVVSEKFQRDLDLDRD
KVNVNGGSIALGHPIGATGAILIGTVLDELERTGGRYGLVTMCAAGGMAPAIIIERL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagcctatatcattgatgccgttcgcacgccgcgcggcatcggcaagaccggc
aagggggcgctcgcccatctgcacccccagcagctcgcggcgagcgtgctcaaggcgctc
cgggagcgcaacggcttcgacactgccgacgtcgacgacatcatctggtcgacctcgatg
cagcgcggcacgcagggcggcgatctcggccggatggcggcgctcgacgcgggctatgac
gtgcgggcctccggggtcacgctcgatcgctattgcggcggcggcatcaccgcggtcagc
cttgccgcggcgcagatcatggcggggatggaggatctgctgatcgcgggcggcagcgag
atgatgtcgctgaccgccaccctctcgcagcaggaggccgcggcggggctgccggtctac
gggatcggatcgggcaatgaccggctccaggccgtccacccccagtcgcaccagggcgtc
tgcggcgacgcgatcgccgcgctggaggggatcggccgcgaggagctcgacgcagccggg
ctggagagccagcgccgcgccgaccgcgcgatccgcgagggccgcttcgccaggagcctc
gtcccggtggtagacgacgaaggccgggtgctgctcgacgccgacgaatatccccggccg
cagaccacggccgaggggctcgcccagctcaagcccgccttcgaggcgctcgcccggacg
ccgatcgacgagacgggcaccacctatgccggcctgatcaaccgtaaattccccgatctc
gacatccggccggtccaccatgccggcaattcgtcgggcgtggtcgacggcgcggcggcg
ctgctgctcgcgtcgaaggattatgccgagcgtcatgggctgaagccgcgcgcccgcatc
gtcgccaccgccaatgtcggcgacgatcccacgctgatgctcaacgcgccggtgcccgcg
gcgcgcaaggcgttgaagaaggctggcctgacaaaggacgacatcgatctctgggagatc
aacgaggcctttgcggtggtttccgagaaattccagcgcgatctcgatctcgatcgcgac
aaggtcaacgtcaatggcgggtcgatcgcgctcggccatccgatcggcgccaccggcgcg
atcctgatcggcaccgtgctcgacgagctcgaacggaccggcgggcgctacgggctcgtc
accatgtgtgcggcgggcggcatggcgcccgcgatcatcatcgagcggctgtga

DBGET integrated database retrieval system