KEGG   Sphingomonas wittichii: Swit_2350Help
Entry
Swit_2350         CDS       T00538                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
swi  Sphingomonas wittichii
Pathway
swi00010  Glycolysis / Gluconeogenesis
swi00051  Fructose and mannose metabolism
swi00562  Inositol phosphate metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
swi01230  Biosynthesis of amino acids
Module
swi_M00002  Glycolysis, core module involving three-carbon compounds
swi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_2350
   00051 Fructose and mannose metabolism
    Swit_2350
   00562 Inositol phosphate metabolism
    Swit_2350
Enzymes [BR:swi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Swit_2350
Exosome [BR:swi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Swit_2350
  Exosomal proteins of bladder cancer cells
   Swit_2350
  Exosomal proteins of melanoma cells
   Swit_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ68709
UniProt: A5V8U3
Position
complement(2611591..2612343)
Genome map
AA seq 250 aa AA seqDB search
MGLRKLVAGNWKMNGSLGSLAELDAIAAAAKAQASVDVAVCPPFTLIAPAAARQPGLAIG
AQDCHAQPKGAHTGCVSAAMLVEAGARLAIVGHSERRADQHETDAEVRAKAAAAIAAGLT
AIVCVGETEAERDAGRAVAVVEGQLDGSIPRDGTAATLVVAYEPVWAIGTGRTPSTADVA
EMHAAIRARLGALLGGEGAGVRILYGGSVKPDNAAELLAVADVDGALVGGASLTAAQFVP
IIEGAAAASV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgggactgcgcaagctcgtcgccggcaactggaagatgaacggatcgctcggcagcctc
gccgaactcgatgcgatcgccgcggcggcgaaggcgcaggcttcggtcgacgtggcggtc
tgcccgcccttcacgctgatcgccccggcggcggcgcgccagcccggcctcgcgatcggc
gcgcaggattgccatgcccagcccaagggcgcccataccggctgcgtcagcgccgcgatg
ctggtcgaggcgggcgcccggctggcgatcgtcggccatagcgagcgccgcgccgaccag
cacgagaccgatgccgaggtccgggccaaggcggcggcggcgatcgccgccggcctgacc
gcgatcgtctgcgtcggcgagaccgaggccgagcgcgacgccggccgcgcggtcgcggtg
gtcgaagggcagctcgacggatcgatcccgcgcgacggcaccgccgcgacgctggtcgtc
gcctatgagccggtctgggcgatcggcaccggccggaccccgtcgaccgccgacgtcgcc
gagatgcacgcggcgattcgcgccaggctgggcgcgctgctcggcggcgagggcgcgggg
gtgcgcatcctctacggcggctcggtgaagcccgacaatgcggccgagctgctcgcggtc
gccgacgtcgacggcgcgctggtcggcggcgccagcctgaccgccgcgcagttcgtgccg
atcatcgaaggcgcggcggccgcttcggtctga

DBGET integrated database retrieval system