KEGG   Sphingomonas wittichii: Swit_2401Help
Entry
Swit_2401         CDS       T00538                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
swi  Sphingomonas wittichii
Pathway
swi00670  One carbon pool by folate
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
swi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Swit_2401
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Swit_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ABQ68760
UniProt: A5V8Z4
Position
complement(2669861..2670805)
Genome map
AA seq 314 aa AA seqDB search
MTSVPLSQLEEARRALDTPLFADLAGDAAVSFEFFPPKTEKMEETLWSAIQTLGPLRPRF
VSVTYGAGGSTRERTHHTVARIAGETAIPAAAHLTCVEASKAEIEEIAREYWAAGVRHIV
ALRGDPPTEGTRFAPHPDGYRNAAELVAGLKAIHPFEISVAAYPECHPEAVSFDSDIANL
KAKFDAGATRAITQFFFSPEAYFRFCDKARAAGIEGEIVPGILPVSNVAQTRKFAGLCGA
AIPAWMDRLFEGLDDHPAARQLVAATIAAEMCRRLYAGGVRQFHFYTLNRAELSYAICHL
LGLRAKADRLENAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcgttcccctgagccagctcgaagaagcgcgccgcgcgctcgacaccccgctg
ttcgccgacctggccggcgacgccgcggtctcgttcgaattcttcccgcccaagacggag
aagatggaggagacgctgtggagcgcgatccagacgctcggcccgctgcgtccgcgcttc
gtctcggtcacctacggcgcgggcggctcgacccgcgagcggacccaccacaccgtcgcc
cgcatcgccggggagacggcgatcccggccgccgcgcacctgacctgcgtcgaggcgagc
aaggccgagatcgaggagatcgcccgcgaatattgggcggccggcgtccgccacatcgtc
gcgctgcgcggcgatccgccgaccgagggcacgcgcttcgccccccatcccgacggctat
cgcaacgccgccgagctggtcgccggactgaaggcgatccatccgttcgagatatcggtc
gcggcctatcccgaatgccatcccgaggcggtgagcttcgacagcgatatcgccaacctc
aaggcgaagttcgacgccggcgcgactcgcgcgatcacccagttcttcttctcgcccgag
gcctatttccgcttctgcgacaaggcgcgcgcggcggggatcgagggggagatcgtcccc
ggcatcctgcccgtgtcgaacgtcgcccagacccgcaagttcgccgggctgtgcggcgcc
gcgatcccggcctggatggaccggctgttcgagggactggacgaccatcccgccgcccgc
cagctcgtcgccgcgacgatcgccgccgagatgtgccgccgcctctatgccggcggcgtc
cgccagttccatttctacacgctcaaccgcgccgagctgtcctacgcgatctgccacctg
ctggggctgcgcgcgaaggccgaccggctggagaatgccgcatga

DBGET integrated database retrieval system