KEGG   Sphingomonas wittichii: Swit_2727Help
Entry
Swit_2727         CDS       T00538                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
swi  Sphingomonas wittichii
Pathway
swi00260  Glycine, serine and threonine metabolism
swi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01130  Biosynthesis of antibiotics
swi01230  Biosynthesis of amino acids
Module
swi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swit_2727
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Swit_2727
Enzymes [BR:swi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Swit_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF4307 BtpA
Motif
Other DBs
NCBI-ProteinID: ABQ69083
UniProt: A5V9W7
Position
3009985..3010800
Genome map
AA seq 271 aa AA seqDB search
MTRLAETFARTRAEGRAALVTFVTGGDPTPGDMGPILDALVAGGADVIELGMPFTDPMAD
GPAIQRANLRALGAGTTTADLLAIAAAFRQRHPSVPLVLMGYANPMVRRGPEWFAAEAAK
AGVDGVICVDIPPEQDGALGPALRAAGVAPIRLATPTTDAARLPAVLEGASGFLYYVSVA
GITGMQQAGQASIEAAVARFKAATDLPVAVGFGVRGPEQAEAIGRVADGVVVGSAIVDLI
GEHGAAAAGPVRDFTATLSAALRRAAQEKAA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcctcgccgagaccttcgcccgcacccgcgccgaggggcgggccgcgctcgtc
accttcgtcaccggcggcgatccgacccccggcgacatgggaccgatcctcgacgcgctg
gtcgcgggcggcgccgacgtgatcgagctgggcatgcccttcaccgatccgatggccgac
ggcccggcgatccagcgcgccaacctccgcgcgctcggcgcggggacgaccaccgccgac
ctgctggcgatcgccgccgccttccgccagcgccacccctcggtgccgctggtgctgatg
ggctatgccaatccgatggtccggcgcggccccgaatggttcgccgccgaggccgccaag
gccggggtcgacggggtaatctgcgtcgacatcccgcccgagcaggacggcgcgctcggc
ccggcgctgcgcgcggccggggtcgccccgatccgcctcgccaccccgaccaccgacgcc
gcccggctgccggcggtgctggagggcgcgtcgggcttcctctattatgtctcggtggcg
gggatcaccggcatgcagcaggccggacaggccagcatcgaggcggcggtcgcgcgcttc
aaggcggcgaccgacctgccggtcgcggtcggcttcggtgtgcgcgggcccgagcaggcc
gaggcgatcggccgcgtcgccgacggcgtcgtcgtcggttcggcgatcgtcgacctgatc
ggcgagcatggcgccgccgccgcgggcccggtccgcgatttcaccgccaccctcagcgcg
gcgctgcgccgcgccgcccaggagaaggccgcatga

DBGET integrated database retrieval system