KEGG   Sphingomonas wittichii: Swit_3064
Entry
Swit_3064         CDS       T00538                                 

Definition
(GenBank) Extradiol ring-cleavage dioxygenase, class III enzyme, subunit B
  KO
K15061  OH-DDVA oxygenase
Organism
swi  Sphingomonas wittichii
Pathway
swi00627  Aminobenzoate degradation
swi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Swit_3064
SSDB
Motif
Pfam: LigB NICE-3
Other DBs
NCBI-ProteinID: ABQ69414
UniProt: A5VAU8
Position
3362184..3363206
AA seq 340 aa
MAEIVLGIWTTHGPTLSTTPEQWLLRLPADRARGNHHFRGATYDFDALVALRDDERLAEQ
ASLVERTRRAEACQAAIRTLADIYERARIDVAVIFGNDQHELFTEALMPAFTIFNGPTIW
NEPASAEQARKMAPGIHEAEAGHNPEVYTEYPGAPELADHIIRQAVSDQFDVTRCARLPE
QPGHWNSGIGHAFGFVYRRIMRDRVAPNVPIVTNTFFPPNQPSARRCFELGRSVARAIRS
WPGDARVAVFGSGGMSHFVIDEAFDRHLFDALQARDAEALCTIGEEHLQSGTSELKNWIA
AAGCLFDTPLSGGIVDYQPCYRSEAGTGTANGFMAWTQGG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgagatcgtcctcggcatctggaccacgcacgggccgaccctgtcgaccacgccc
gagcagtggctgctccggctgcccgccgaccgggcgcgcggcaatcaccatttccggggc
gcgacctatgatttcgacgcgctggtcgcgttgcgggacgacgagcggctggccgagcag
gcctcgctcgtcgagcgcacccgccgcgcggaggcgtgccaggccgcgatccgtacgctg
gccgacatctacgaacgcgcccggatcgacgtcgcggtgatcttcggcaacgaccagcac
gagctgttcaccgaggcgctgatgccggccttcaccatcttcaacggcccgaccatctgg
aacgagccggccagcgccgaacaggcgaggaagatggcgcccggcatccacgaggccgag
gcggggcacaatcccgaagtctataccgaatatcccggggcgcccgaactggccgaccat
atcatccgccaggcggtgtcggaccagttcgacgtgacgcgctgcgcccggctgcccgag
cagcccgggcattggaacagcggcatcggccacgccttcggcttcgtctatcgccggatc
atgcgcgatcgggtggcgcccaacgtcccgatcgtgaccaacaccttctttccgcccaac
cagccgtcggcgcggcgctgcttcgagctgggccggtcggtggcgcgggcgatccgttcc
tggcccggcgacgcccgcgtcgcggtgttcggatcgggcggcatgagccatttcgtgatc
gacgaggcgttcgatcgccacctgttcgacgccttgcaggcgcgcgacgccgaggcgctg
tgcacgatcggggaggagcatctccagtcgggcacctcggagctcaagaactggatcgcg
gcggcgggctgcctgttcgacacgccgttgtcgggcggcatcgtcgactatcagccctgc
taccgatcggaagcgggcaccggcacggccaacggcttcatggcctggacacaaggagga
tga

DBGET integrated database retrieval system