KEGG   Sphingomonas wittichii: Swit_3133Help
Entry
Swit_3133         CDS       T00538                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
swi  Sphingomonas wittichii
Pathway
swi00010  Glycolysis / Gluconeogenesis
swi00260  Glycine, serine and threonine metabolism
swi00680  Methane metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
swi01230  Biosynthesis of amino acids
Module
swi_M00002  Glycolysis, core module involving three-carbon compounds
swi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swit_3133
  Energy metabolism
   00680 Methane metabolism
    Swit_3133
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Swit_3133
Enzymes [BR:swi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Swit_3133
Membrane trafficking [BR:swi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Swit_3133
Exosome [BR:swi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Swit_3133
  Exosomal proteins of melanoma cells
   Swit_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Peptidase_S24
Motif
Other DBs
NCBI-ProteinID: ABQ69481
UniProt: A5VB15
Position
complement(3445452..3446138)
Genome map
AA seq 228 aa AA seqDB search
MPTLVLIRHGQSAWNLENRFTGWWDVNLTDQGIAEAKAAGELMAAKGLDFDQCYTSFQTR
AIKTLNIALEAMGRLWLPVEKDWRLNERHYGGLTGLNKAETAARHGDAQVKVWRRSFDIP
PPVLEPGGEFDLSKDRRYAGIAIPSTESLKDTIARVLPYWEERIAPDLKAGKRVVISAHG
NSLRALVKHLSHIPDDEITELEIPTGQPIVYELADDLTARDRYYLSER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgctcgtcctgatccgccatggccagtccgcctggaatctggaaaaccgcttc
accggctggtgggatgtcaacctgaccgaccagggcatcgccgaggcgaaggcggccggc
gagctgatggccgccaagggcctcgacttcgaccagtgctacaccagcttccagacccgc
gcgatcaagacgctcaacatcgcactggaggcgatgggccggctgtggctgccggtcgag
aaggactggcgcctcaacgagcggcactatggcgggctgaccgggctcaacaaggccgag
accgcggccaggcatggcgacgcgcaggtcaaggtgtggcgccgcagcttcgacatcccg
ccgccggtgctcgaaccgggcggcgagttcgacctgtcgaaggaccgccgctacgccggc
atcgcgatccccagcaccgagagcctgaaggacacgatcgcgcgcgtcctgccctattgg
gaggagcggatcgcgcccgacctgaaggcgggcaagcgggtggtgatctccgcgcacggc
aattcgctgcgcgcgctggtcaagcatctgtcgcacattcccgacgacgagatcaccgag
ctggagattccgaccggccagccgatcgtctacgagctggccgacgacctgacggcgcgg
gaccgctattatctgtcggagcgctga

DBGET integrated database retrieval system