KEGG   Sphingomonas wittichii: Swit_3197Help
Entry
Swit_3197         CDS       T00538                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
swi  Sphingomonas wittichii
Pathway
swi00020  Citrate cycle (TCA cycle)
swi00640  Propanoate metabolism
swi00660  C5-Branched dibasic acid metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
swi01120  Microbial metabolism in diverse environments
swi01130  Biosynthesis of antibiotics
swi01200  Carbon metabolism
Module
swi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Swit_3197
   00640 Propanoate metabolism
    Swit_3197
   00660 C5-Branched dibasic acid metabolism
    Swit_3197
Enzymes [BR:swi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Swit_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABQ69544
UniProt: A5VB78
Position
complement(3514195..3515394)
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKELLAKFGVAVPAGHAALTVDEAVEAAKKLPGPIWVVKAQIHAGGRGKGKFK
ELPADAKGGVRLSKSIDEVKANAADMLGNTLVTIQTGEAGKQVNRLYVTDGADIKSEYYL
SMLVDRKTGRIAMIVSTEGGMDIEQVAHDTPEKIRTIVIDPAEGFQPHHGRAVAFALKLK
GDLNKQAVKLAEQLYNAFIATDMSMLEVNPLVETTDGKLLVLDAKVSFDSNALYRHPDIL
ALRDETEEDPAEIEASQYDLAYIKLDGDIGCMVNGAGLAMATMDIIKLNGMFPANFLDVG
GGATKEKVTAAFKIILSDPAVKGILVNIFGGIMRCDIIAEGIIAAAKEVNLSVPLVVRLE
GTNVQQGKDLLAGSGLPIVAADDLGDAARKIVAEVKKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggccaaggaactgctggcgaagttcggcgtcgcggtcccc
gcgggccacgccgccctgaccgtcgacgaggccgtcgaggccgccaagaagctccccggg
ccgatctgggtggtcaaggcgcagatccacgcgggcggccgcggcaagggcaagttcaag
gaactgccggccgacgccaagggcggcgtccgcctgtccaagtcgatcgacgaggtcaag
gccaacgccgccgacatgctcggcaacaccctcgtcaccatccagacgggcgaggccggc
aagcaggtcaaccgcctctatgtgaccgacggcgccgacatcaaatccgaatattatctg
tcgatgctggtcgaccggaagaccggccgcatcgcgatgatcgtgtcgaccgagggcggc
atggacatcgagcaggtcgcccatgacacgcccgagaagatccgcaccatcgtgatcgac
ccggccgagggcttccagccgcaccatggccgcgccgtcgccttcgcgctgaagctgaag
ggcgatctcaacaagcaggcggtcaagctcgccgagcagctctacaacgccttcatcgcc
accgacatgtcgatgctcgaggtcaatccgctggtcgagacgacagacggcaagctgctt
gttctcgatgcgaaggtcagcttcgactcgaacgcactctatcgccatcccgacatcctc
gcgctgcgcgacgagaccgaggaggacccagccgagatcgaggcgtctcaatatgatctc
gcctatatcaagctggacggcgacatcggctgcatggtcaacggcgccggcctcgccatg
gcgacgatggacatcatcaagctcaacggcatgttcccggccaacttcctcgacgtcggc
ggcggcgccacgaaggagaaggtgaccgcggcgttcaagatcatcctgagcgacccggcg
gtgaagggcattctcgtcaacatcttcggcgggatcatgcgttgcgacatcatcgccgag
ggcatcatcgccgcggcgaaggaagtgaacctgtcggttccgctggtcgtccgcctcgaa
ggcaccaacgtccagcagggcaaggacctgctcgccggttcgggcctgccgatcgtcgcc
gccgacgacctgggcgacgccgcccgcaagatcgtcgccgaggtgaagaaggcggcctga

DBGET integrated database retrieval system