KEGG   Sphingomonas wittichii: Swit_3438Help
Entry
Swit_3438         CDS       T00538                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase (GDP)
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
swi  Sphingomonas wittichii
Pathway
swi00051  Fructose and mannose metabolism
swi00520  Amino sugar and nucleotide sugar metabolism
swi01100  Metabolic pathways
swi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Swit_3438
   00520 Amino sugar and nucleotide sugar metabolism
    Swit_3438
Enzymes [BR:swi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Swit_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABQ69784
UniProt: A5VBW8
Position
complement(3771710..3772795)
Genome map
AA seq 361 aa AA seqDB search
MEPAISTTLITPVILSGGSGTRLWPLSRSRRPKQLLALTGERTMLQMTAGRCADRARFGP
SIIVTNALHAAEIATQLQHDRPAAIILEPAGRNTAPAIALAALESAPDAPLLVMPSDHVI
DDVAAFHAAIAAAMPLVRDGWLVTFGITPDTPETGYGYIRRGADIAPGVQKVDAFVEKPD
LDRARAYLAEGNYSWNGGIFLFRADAYLAALDRFEPEMLAAVRASLDGAARDGSMVIPAA
EAFLSARSESIDYAVMEKADRVAVVPVEMGWSDVGSWDALHLLGLPDEQGNVVQGDVVAI
DTSGCLIRSEGPVVTTAGIHDLIVVATRDAVMILPRGSSQEVKTIVEALKARGHETLDAP
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgccatttccaccaccttgataacccccgtcatcctgtcgggcgggtccgga
acccgattgtggccgctgtcgcggtcgcgccggccgaagcagctgctggcgctgaccggc
gaacggacgatgttgcagatgaccgccgggcgctgcgccgaccgggcgcgcttcggcccg
tcgatcatcgtcaccaacgcgcttcacgccgccgagatcgcgacccagctccagcacgac
cggccggcggcgatcatcctggagccggcggggcgcaacaccgcccccgcgatcgcgctg
gccgcgctcgaatcggcgcccgacgcgccgctgctggtgatgccgagcgaccatgtgatc
gacgacgtcgccgccttccacgccgcgatcgcggcggcgatgccgctggtccgcgacgga
tggctggtcaccttcggcatcacccccgacacgcccgagaccggctatggctatatccgc
cgcggcgcggacatcgcgccgggcgtgcagaaggtcgacgccttcgtcgagaagcccgac
ctcgaccgcgcccgcgcctatctggccgagggcaactacagctggaacggcggcatcttc
ctgttccgcgccgacgcctatctcgccgcgctcgaccggttcgagcccgagatgctggcg
gcggtgcgcgcctcgctcgacggcgccgcgcgcgacggcagcatggtcatcccggccgcc
gaggccttcctgtcggcgcggtccgaatcgatcgactatgcggtgatggagaaggccgac
cgggtcgccgtggtgccggtcgagatgggctggtccgacgtcgggagctgggacgcgctg
cacctgctcggccttcccgacgagcagggcaacgtcgtccagggcgacgtcgtggcgatc
gacaccagcggctgcctgatccgcagcgaggggccggtcgtcaccaccgccggcatccac
gacctgatcgtggtggcgacgcgcgacgcggtgatgatcctgccgcgcggcagcagccag
gaggtcaagacgatcgtcgaggcgctcaaggccagggggcacgagacgctcgacgccccc
ttctga

DBGET integrated database retrieval system