KEGG   Sphingomonas wittichii: Swit_3605Help
Entry
Swit_3605         CDS       T00538                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
swi  Sphingomonas wittichii
Brite
KEGG Orthology (KO) [BR:swi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Swit_3605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABQ69951
UniProt: A5VCD5
Position
complement(3964435..3965433)
Genome map
AA seq 332 aa AA seqDB search
MEIISFPLLVGLIAIALAFDFLNGLHDAANSIATVVSTRVLKPHQAVAMAAFFNFIAFLF
FGLHVAETVGKGIVHADIIDAHVIFGALMGAISWNLITWLLGIPSSSSHALIGGLLGAGT
AKAGVGSIVWSGVLKTSFAIVLSPTIGLVLALLLVLITSWVFVRSTPGAADKRYRRLQLI
SASLYSLGHGGNDAQKTMGIIAVLLYSQGLLGGAFHVPFWVVISCQAAMGLGTLAGGWKI
VHTMGSKITRLTPAQGFCAETGGAITLFTATWLGVPVSTTHTITGAIVGVGSSRRLSAVR
WNVASSIVVAWVVTLPAAAAFGAGFYLLAGLF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatctccttcccgctgctggtcgggctgatcgccatcgcgctggcgttcgac
ttcctgaacggcctgcacgatgcggcgaactcgatcgcgacggtggtgtcgacccgcgtg
ctcaagccgcaccaggcggtggcgatggcggccttcttcaacttcatcgccttcctgttc
ttcggcctccacgtcgccgagacggtgggcaaggggatcgtccatgccgacatcatcgac
gcgcatgtgatcttcggcgcgctgatgggggcgatcagctggaacctgatcacctggctg
ctcggcatcccctcctcgtccagccacgccctgatcggcggcctgctcggcgcgggcacg
gccaaggccggggtgggctcgatcgtctggtcgggcgtgctcaagaccagcttcgcgatc
gtgctgtcgccgacgatcggcctcgtcctcgcgctgctgctggtgctgatcacgagctgg
gtgttcgtgcgcagcacgccgggcgccgccgacaagcgctaccgccggctgcagctcatc
tcggcctcgctctactcgctcggccatggcggcaacgacgcgcagaagacgatggggatc
atcgccgtgctgctctattcgcaaggcctgctcggcggcgccttccacgtccccttctgg
gtggtgatcagctgccaggcggcgatgggcctcggcacgctcgccggcgggtggaagatc
gtccacaccatgggatcgaagatcacccggctgaccccggcgcagggcttctgcgcggag
accggcggcgcgatcaccctgttcaccgcgacctggctgggcgtgccggtgtcgaccacc
cacaccatcaccggcgcgatcgtcggcgtgggctcgtcgcggcgactgtcggcggtgcgc
tggaacgtcgccagcagcatcgtcgtcgcctgggtggtcaccctccccgccgccgccgcg
ttcggcgcgggcttctacctgctggcggggctgttctag

DBGET integrated database retrieval system