KEGG   Sphingomonas wittichii: Swit_4077Help
Entry
Swit_4077         CDS       T00538                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
swi  Sphingomonas wittichii
Pathway
swi00480  Glutathione metabolism
swi00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:swi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Swit_4077
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Swit_4077
Enzymes [BR:swi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Swit_4077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ABQ70420
UniProt: A5VDQ4
Position
complement(4475562..4476050)
Genome map
AA seq 162 aa AA seqDB search
MTTVYDFSARAIDGSEVPLDRWRGKVLLIVNTASQCGFTPQYAGLEMLHEQLSDRGLVVL
GFPCNQFGGQEPGSEAEIDAFCRTSYDVRFPMFAKVEVNGPAAHPLYGWLKSNARGILGT
EGIKWNFTKFLIDRSGQVFSRYAPTTKPEAIRGEIEELLEDA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgtctatgacttctcggcccgcgcgatcgacggcagcgaggtcccgctcgac
cgctggcgcggcaaggtgctgctgatcgtcaacaccgccagccagtgcggcttcaccccg
caatatgcggggctcgagatgctgcacgagcaattgtccgaccgcgggctggtggtgctc
ggcttcccctgcaaccagttcggcgggcaggagccgggcagcgaggcggagatcgacgcc
ttctgccgcaccagctacgacgtccgcttcccgatgttcgccaaggtcgaggtcaacggc
ccggccgcccacccgctctacggctggctgaagagcaacgcgcgcggcatcctcggcacc
gagggcatcaagtggaacttcaccaaattcctgatcgaccgctccggccaggtgttcagc
cgctacgccccgaccaccaagcccgaggcgatccgcggcgagatcgaggaactgctcgaa
gacgcctga

DBGET integrated database retrieval system