KEGG   Sphingomonas wittichii: Swit_4393Help
Entry
Swit_4393         CDS       T00538                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
swi  Sphingomonas wittichii
Pathway
swi00330  Arginine and proline metabolism
swi00360  Phenylalanine metabolism
swi00380  Tryptophan metabolism
swi00627  Aminobenzoate degradation
swi00643  Styrene degradation
swi01100  Metabolic pathways
swi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Swit_4393
   00360 Phenylalanine metabolism
    Swit_4393
   00380 Tryptophan metabolism
    Swit_4393
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Swit_4393
   00643 Styrene degradation
    Swit_4393
Enzymes [BR:swi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Swit_4393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: ABQ70731
UniProt: A5VEL5
Position
4845380..4846732
Genome map
AA seq 450 aa AA seqDB search
MDEAFDLDVTELGSRYRDRTLSPVEVEQGLSARIARLDPELGAFTALAGEEARTAARQAE
AELAAGIDRGPLHGVPVTVKDLCLTRDMPTAAGLRGFAERLPRRDAAVVARLREAGAVLV
GKTYTTAGAFVDPAADRPFPRHPGRADIFPGMSSTGAGVAVAAGLCSVAIGTDTGGSIRL
PSMCCGVSGFKPAYRRVDAEGVFESAPSLDHVGPIARSVADLAAAMTAIGEGESPRALVT
DLAAVRIGVDRRALELTGPKSRGAIERAIGLFGELGVTAVEVTLPPVAELLAATGRLQAW
ETAAVHAAWYPAHRGDYGPGLAATIDRGRAMQAGDLDDFEAVRAAYRQQLDALFATVDLI
ILPVLTIDTPTLDEWEGAMRQADPLGARFTKPFNVTGHPALALPGGFDADGLPLGFQLVA
RPADEAFLLGAGVAFQKISDWHRGLPRALP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagcgttcgatctcgacgtcaccgaattgggcagtcgctatcgtgaccggacg
ttgtcgccggtcgaggtcgaacaggggctgtcggcgcggattgcccggctcgatccggag
ctgggcgccttcaccgcgctggcgggagaggaagcacggacggcggcgcggcaggcggag
gccgagctcgcggccgggatcgatcgcggcccgctgcacggcgtcccggtgacggtcaag
gacctctgcctcacccgcgacatgccgaccgcggcggggctgcgcggcttcgcggagcgg
ctgccgcggcgcgacgcggcggtggtggcgcggctgcgcgaagcgggggcggtgctggtc
ggcaagacctatacgacggcgggcgccttcgtcgatccggcggcggaccggccctttccg
cgccatccgggacgcgcggatatctttcccgggatgtcgtcgaccggcgccggcgtggcg
gtggcggcggggctctgctcggtcgcgatcgggaccgacaccggcgggtcgatccggctg
ccgtcgatgtgttgcggggtgagcgggttcaagccggcctatcggcgggtcgacgccgaa
ggcgttttcgagtccgcgccgtcgctcgatcatgtcgggccgatcgcccgcagcgtcgcc
gatctggcggcggcgatgacggcgatcggggagggtgagagcccgcgcgccctcgtcacc
gatctcgcggctgtgcggatcggcgtcgatcgccgcgccctggaactgaccgggccgaaa
agccggggtgcgatcgagcgggcgatcgggctgttcggcgagctcggcgtgacggcagtc
gaggtgacgctgccgccggtcgcggagctgctggcggcgaccggccggttgcaggcgtgg
gagacggcggcggtccatgccgcctggtatccggcccatcgcggggactatgggccgggc
ctcgccgcgacgatcgaccggggccgggcgatgcaggccggcgatctcgacgatttcgaa
gcggttcgggccgcctatcgccagcagctcgacgcgctgttcgccacggtcgacctgatc
atcctgccggtgctgacgatcgacacgccgacgctggacgaatgggagggggcgatgcgg
caggcggacccgctgggcgcgcgcttcaccaagccgttcaacgtgaccggccaccccgcg
ctcgcgctgcccggcggcttcgatgcggacggcttgccgctgggcttccagctcgtcgcg
cggccggcggacgaagccttcctgctcggcgccggagtcgccttccagaagatcagcgac
tggcatcggggcctgccgcgcgccctgccgtag

DBGET integrated database retrieval system