KEGG   Sphingomonas wittichii: Swit_5004Help
Entry
Swit_5004         CDS       T00538                                 

Definition
(GenBank) VirB8 family protein
  KO
K03203  type IV secretion system protein VirB8
Organism
swi  Sphingomonas wittichii
Pathway
swi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:swi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Swit_5004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swi02044]
    Swit_5004
Secretion system [BR:swi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Swit_5004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 Mub_B2
Motif
Other DBs
NCBI-ProteinID: ABQ71620
UniProt: A5VH54
Position
pSWIT02:complement(121409..122098)
Genome map
AA seq 229 aa AA seqDB search
MRNQTEGVPAKDAELYFGHARSWDQDRQRKSLRSERIAWVVAGLGLLAATAEGFALAGLA
PLKTVMPYIIRVNQTTGAVDVQTTLTQKPMRYDEAVTKFFLAQYVRARESWLPAAAEENF
RAVTILSEPGEQQRWGRFFNSNNAASPQVVWGKGAVVQARVRNIAFINDRVANVRFTRTV
QTDTDTQSSDWIATVTFRYTNAPMAEGDRYRNPLGFQVENYRADPEVVR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaccagaccgaaggcgtgccggcaaaagacgctgaactctatttcgggcatgcc
cgatcgtgggatcaggaccgtcagcgcaaatcgttacgatccgaacgcatcgcctgggtc
gtggccggcctggggctgcttgccgcgaccgcggagggcttcgcactcgcgggcctggcc
ccgctgaaaacggtcatgccgtacatcattcgcgtcaatcagaccacaggcgcggtcgat
gtgcagaccaccctcacccagaagccgatgcgctatgacgaggcggtcacgaaattcttc
ctcgcacaatatgtcagggcgagagagagctggttgccggcggcggccgaggagaatttt
cgcgctgtcacaatcctgtccgaaccaggcgagcagcagcgctggggccggtttttcaac
tcgaacaacgccgcgagcccacaggtcgtctggggcaagggtgcggtcgtccaggcccgc
gtgcgcaatatcgccttcatcaacgatcgtgtggccaatgtccgtttcacgcggacagtg
cagaccgacaccgatacgcagagcagcgactggatcgcaacggtcaccttccggtacacg
aatgcgccgatggcggagggcgatcgctatcgcaacccattggggttccaggtcgagaat
taccgcgcggacccagaggtggtgcggtga

DBGET integrated database retrieval system