KEGG   Sphingomonas wittichii: Swit_5160Help
Entry
Swit_5160         CDS       T00538                                 

Definition
(GenBank) TraD
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 FtsK_SpoIIIE AAA_22 T2SSE cobW AAA_16 NACHT ATP_bind_1 SRP54 AAA_7 Pox_A32 AAA_10 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABQ71271
UniProt: A5VG55
Position
pSWIT01:complement(54040..56346)
Genome map
AA seq 768 aa AA seqDB search
MAREDIRTDGRPVPLTHHSARGRVQRNAGNFTRGSQLLTHEMLMWFSGAKLPFILWFFAF
LAAWFIIMSLKLDEHGFQLVCMKVYATLWNWIDLNPNKRVNVTLPNGDLMRTVMKAVPYI
PEVITAWAVAMRGLIGAFLISVFITIPAAIWFVDISHRRGRSILQERHERGAMLVDRSVL
LVEINEHNRVKFEEEAADLFPGLSSRQVLALPFRARKEAGIHHPYTLAGIPFPHRTEQSH
AMLIGTTGSGKTTELRSLVTQMRERQDTAVIFDLTGAYVEAFYDPTRDTILNPMDARCPA
WSIFNDCRTHSEFTAAAAALIPSDGGSSEPFWALAARTLFIEMCIRLMERGQTSNLALSE
NLMTADLKRVHRFLANTIADPLTAPEAARMAESIRAVFNTNAQVLRFLPDEGESFSIRDW
ITRDKKPGSILFVTSNYVDLPMNRALLTLWMDLAINRLMTLPRTRSLRTWFMFDELGALH
RLPAIENGLQTARAFGGAMILGIHSFEKLVEVYGEQGARNLASLARSKLILATADLDTAE
QCARYIGNREVRQMDEAYSYGYNNTRDASTLTPRKQVEPLVIADDITNLPSMHGFVKFPD
GFPAARILLEWKDYPQVAQGFVQRPDVGPVRSRRGEEVFEEDGAGEAGGRDGSLQVVEEV
AEITNLARDLAARILSAEVEEEDDAARRAAQRADDRDEQATPGTHSADRAQAARASGEEQ
PVSARDRDDRRDGHRHGETSPQVEDQTLIELRHDFSTGREDDGMDMGI
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgaggacatccgcacggacgggcgtcccgtcccgctcacccatcattcggcg
cgcggccgcgtgcagcgcaatgccggcaatttcacccgcggcagccagctactcacccat
gagatgctgatgtggttctcgggcgccaagctgcccttcatcctctggttcttcgccttt
ctcgccgcctggttcatcatcatgtcgctcaagctcgacgagcatggtttccagctcgtc
tgcatgaaggtctatgcgaccctctggaactggatcgacctcaatccgaacaagcgcgtc
aacgtcacgctgccgaacggcgacctcatgcgcaccgtgatgaaagcggtgccctatatt
cccgaggtcatcacagcctgggccgtcgcgatgcggggcctcatcggcgctttcctgatc
tcggtcttcatcaccattccggccgccatctggttcgtcgacatctcgcatcggcgcggc
cgttcgatccttcaggaacggcatgaacgcggcgccatgctggttgatcgcagcgtgctt
ctggtggagatcaacgagcataaccgggtgaagttcgaagaggaggcggccgacctcttc
cccggcctgtcctcgcggcaggttctcgcgctcccgttccgagcgcgcaaggaagccggc
atccatcatccctacacgctcgcgggcatcccctttccgcaccgcaccgaacaatcccat
gcgatgctcatcggcaccaccggatcaggcaagacgaccgagctcagaagcctcgtcacc
cagatgcgcgagcgccaggacacggccgtcatcttcgatctcaccggcgcctatgtcgaa
gccttctacgatcccacacgcgacacgatcctcaatcccatggacgcgcgctgcccggcc
tggtcgatcttcaacgattgccgcacccacagcgaattcacggccgccgcggcggcgcta
atcccttcggatggcggttcgtccgaacccttctgggcgctcgcagcgcgcaccctcttc
atcgagatgtgcattcgcctgatggagcgggggcagaccagcaatctggcgctgtccgag
aacctgatgacggccgacctgaagcgcgtccaccgcttcctcgccaacaccatcgccgac
ccgctcactgcccccgaagcggcccgcatggcggaatcgatccgcgccgtcttcaacacc
aatgcgcaggtccttcgcttccttcccgacgagggcgaatccttctcgatccgcgactgg
atcacgcgggacaagaagcccggatcgatcctgttcgtgacgtcgaactatgtcgatctg
ccgatgaaccgggcgctgctcacgctgtggatggatctcgcgatcaaccggctgatgacg
ctgccgcgcacccgcagcttgcgcacctggttcatgttcgacgagcttggcgcactgcat
cgccttccggcgatcgagaatggtctccagacggcgcgcgcgtttggcggcgcgatgatc
ctgggcatccacagcttcgagaagctggtcgaagtctatggcgagcaaggggcacgcaat
ctcgcctcgctcgcccgctccaagctcatcctcgcgacggccgatctcgacacggccgag
cagtgcgcgcgctacatcggcaaccgcgaggttcgccagatggatgaggcctatagctac
ggctacaataacacccgcgacgcttcgaccctgaccccgcgcaagcaggtcgaaccactc
gtcatcgccgatgacatcaccaacctgccctcgatgcacggcttcgtgaaattccccgac
ggcttccccgccgcgcgcatcctgctcgagtggaaggactatccccaggtcgcccagggc
ttcgtccaacggcccgatgtcgggccggtacgctcaaggcgcggagaggaggtgttcgag
gaagacggggcaggggaggcgggcgggcgcgacggctcgttgcaggtcgtggaggaagtg
gccgagatcaccaatctcgcccgcgatctcgccgcacggatcctgtcggccgaggtcgag
gaggaggacgatgccgcccgccgcgcggcgcagcgggcggacgaccgggacgaacaggcg
acgcctggcacgcatagcgcggacagggcgcaggcggcgcgcgccagcggcgaggaacag
ccggtttccgcgcgcgaccgggacgatcgtcgtgatggccaccggcacggggagacgagc
ccacaggtcgaggaccagaccctgatcgagctgcgccacgacttctccaccggccgcgag
gatgacggcatggacatgggcatctga

DBGET integrated database retrieval system