KEGG   Sphingomonas wittichii: Swit_5224Help
Entry
Swit_5224         CDS       T00538                                 

Definition
(GenBank) TraD
Organism
swi  Sphingomonas wittichii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 FtsK_SpoIIIE AAA_22 AAA_33 T2SSE AAA_10 AAA_16 cobW AAA_30 ABC_tran AAA_7 SRP54 AAA_29 Pox_A32 EVC2_like
Motif
Other DBs
NCBI-ProteinID: ABQ71333
UniProt: A5VGB7
Position
pSWIT01:complement(116438..118729)
Genome map
AA seq 763 aa AA seqDB search
MARKNDIRTDGRAIPLTHHSARGRVQRNSGNFTRGSQLLTHELLMWFSGAKLPILMWFFL
FAAAWFVIMSIKLDEHGFQLICMKIYAALWNWVDLNPNKRVNVTLPSGEVMRTVMPAVPY
IAEVIQAWKIAMKGLLAAFFVSIFITIPVALWFVDLSRRRGKTILQERHERGAMLVARHV
LLNEISQHNYAKFEEEAQDRLPGLAPAKILDMPFRARKAAGIHHPYTLAGIPYPHRTEQS
HTMLIGTTGSGKTTELRSLVSQVRAREDTAVIFDLTGAYVEAFYDSARDTILNPMDARCP
AWSIFNDCTTHSEFTAAAAALIPSDGGSAEPFWALAARTLFIEMCIRLQERGATTNLALS
ENLMTADLKRVHRFLANTIADPLTAPEAARMAESIRAVFNTNAQVLRFLPDEGPRFSIRD
WTTTEKKPGAILFITSNYVDLAMNRALLTLWMDIAINRLMTMPRTRDLRTWFMFDELGAL
HRLPAIENGLQTARAFGGAMILGIHSFEKLIEVYGEQGARNLASLARSKLMLATADLDTA
EQCARYIGNREVRQMDEAYSYGYNNTRDAATLTPRKQVEPLVIADDITNLPSMHGFVKFP
DGFPAARIQLQWKDYPQVAQGFIARPNLQPVRSRRGEEAFEGSDGGEAGGRDGAAQVIGE
VADPVNLAKELAANILSAEVEDEHDEAARRAQRAAESDERPATPTHAADRAQAARAATGD
PQTVPRDRDGRGQPAPVPQVEDQTLVELRQAFGREDDGMDMGI
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaaaacgatatccgcacagacggccgggccatccccttgacccatcacagc
gcgcgcggacgggtgcagcgcaattcgggcaattttacccgcggctcgcagcttctcacc
cacgaacttctgatgtggttctcgggtgcgaaactgcccatcctgatgtggttcttcctc
ttcgcggccgcctggttcgtgatcatgtcgatcaagctcgacgagcacggcttccagctc
atctgcatgaagatttatgccgcgctctggaactgggtcgacctcaaccccaacaagcgc
gtcaacgtcaccctgccgagcggcgaggtcatgcgtacggtgatgcccgcggtgccttat
atcgccgaggtcatccaggcctggaagatcgcgatgaaaggccttctggcggccttcttc
gtatccatcttcatcaccatcccggtcgcactctggttcgtcgatctttcgcgccggcgg
ggcaagacgatccttcaggaacgccacgagcgcggagccatgctggtcgcccgccacgtg
cttctcaacgagatcagccagcacaattacgcgaagttcgaagaggaggcgcaggatcgc
ctgcccggcctcgccccggccaagattctcgacatgccgtttcgtgcacgcaaggcggcg
ggcatccatcacccctatacgcttgcgggcatcccttatccgcatcgcaccgagcagtcg
cataccatgctcatcggtacgaccggatcgggcaagacgaccgaactcaggagcctggtt
tcgcaggtgcgagcccgcgaggacacggccgtcatcttcgatctcaccggcgcctatgtc
gaagccttctacgattccgcgcgcgatacgatcctcaacccgatggacgcgcgctgcccg
gcctggtcgatcttcaacgactgcaccacgcatagcgaattcactgccgcagcggcggcg
ctcattccctcggacggcggctctgccgaacccttctgggcgctcgcggcgcgcaccctc
ttcatcgagatgtgcatccggctccaggagcgcggcgcgacgaccaatctcgcgctctcc
gagaacctgatgacggccgacctgaagcgggttcaccgtttccttgccaacacgatcgcg
gacccgctcaccgcgccggaagccgcacgcatggcggaatcgatccgcgcggtcttcaat
accaatgcgcaggtgctgcgcttccttcccgacgaggggccacgcttctcgatccgcgac
tggaccacgaccgagaagaagcccggcgcgatcctgttcatcacctcgaactatgtcgat
ctggcgatgaaccgggcgctgctgacgctgtggatggacatcgccatcaaccgcctcatg
accatgccgcgcacccgcgatctgcgcacctggttcatgttcgacgaactcggcgcactc
catcgtctgcccgcgatcgagaatggtctccagaccgcccgcgcgttcggcggcgcgatg
atcctggggatccacagcttcgaaaaactgatcgaggtctatggcgagcagggtgcccgc
aatctcgcctcgctcgcgcgctccaagctgatgctcgcaaccgccgatctcgacaccgcc
gagcaatgcgcgcgctacatcggcaaccgcgaagtacggcagatggatgaagcctatagc
tacggctacaacaacacgcgcgacgccgcgacgctgacgccgcgcaagcaggtcgagccg
ctcgtcatcgcggacgacatcaccaacctgccctcgatgcatggtttcgtgaaattccct
gatggcttccccgcggcgcgcatccagctccagtggaaagactacccccaggtcgcccag
ggcttcatcgcccgtcccaatctccagccggtgcgatcaaggcgcggagaggaggcgttc
gaggggagcgatgggggcgaagcgggcgggcgcgatggcgccgcgcaggtgatcggggag
gttgccgatcccgtcaatctggccaaggaacttgccgccaatatcctgtcggccgaggtc
gaggatgagcatgatgaagcggcccgccgggcgcagcgtgcggccgagagcgacgagcgg
ccagcaacccccacgcacgccgcggacagggcacaggcggcgcgcgctgcgaccggggat
cctcagaccgtgccgcgcgatcgcgacgggcggggtcaacctgcgccagtgccccaggtc
gaggatcagacgctggtcgagctaaggcaggcgttcgggcgcgaggacgacggcatggac
atggggatctga

DBGET integrated database retrieval system