KEGG   Sphingomonas wittichii: Swit_5371
Entry
Swit_5371         CDS       T00538                                 

Definition
(GenBank) Type-IV secretion system protein TraC
  KO
K12063  conjugal transfer ATP-binding protein TraC
Organism
swi  Sphingomonas wittichii
Brite
KEGG Orthology (KO) [BR:swi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:swi02044]
    Swit_5371
Secretion system [BR:swi02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Swit_5371
SSDB
Motif
Pfam: DUF5934 TraC_F_IV P-loop_TraG AAA_10 DUF87 T4SS-DNA_transf TraG-D_C FtsK_SpoIIIE CbiA Fer4_NifH AAA_16 TrwB_AAD_bind AAA_22 MeaB Mg_chelatase RNA_helicase
Other DBs
NCBI-ProteinID: ABQ71479
UniProt: A5VGR3
Position
pSWIT01:277418..280012
AA seq 864 aa
MAKGGFFDSMLSGLFGDAARPDDDRPALGVPMLAHWLPYRSYDPKTGIFYNSASRGFVIE
AAPMVGADERTAEIITQFLSEGIPAPGCIQFHQWMSPRVGEALSKWYLPRYAARGVYERM
AKHRVDFLSDGVWQSLSKDAPFCLRHHRVAISYSTPESSSVSDDDIVSVMEGLVSALASV
GITTRRMDPVALIAWIDDITSPTTAAGEDVVSYNPFDPIADQAIRRDIELRVEPDRMLLR
TERFRPTGKVHEGAPEIGEIYPDVFDVRSFSVRNLPNRWAPWDMAKLVGDMFTDKLRMPC
PVATNLCVEYPDTQASSNKASFKFMRTTSLADSKSARFLPQLRDQSQEWRFVNDEIRQGR
KLVRVFFSVTSFSPKGRGDANERVLKSVYRAAGWDLLDDRYLQVMGLLCAMPMTMANGLS
RDLERMKRMRTLLTTTAANLAPLQGEYLGGHVPHLLMVGRRGQPFFWSPFENAAGNHNVA
VFGKSGSGKSVALQELCASLCGAGAKVVVIDDGRSFEHSAKLQGGAFVEFTMSSGFCLNP
FSMIDEAQAAEDEDYLLDCMAMLKAIVNQMSRHIDRLNDTERGLIDGAVNTVWEAHGRRG
SIDLVIEALDATGNALAHDLGIAMRPFSAAGTYGRFFQGEVSFELKAQLTVFELSDLSAR
EELRSVVLTAIMFMSQQVMRKVDRAIPKALLLDEAWQLLRGGAMADFIETYARTCRKYGA
SLVTATQSLNDYYKSAGSIAALENSDWFVILQQKPETIADFKKHDRFEMDDYTDALLRSL
KRNGFEYSDIMIKGPETLAVGRLVLDPYSATLFSSSPQTFARIEALIGEGLSMDEAIERI
AFPDNPEKWAANAESDPDVAIAAE
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggcgaaaggcggctttttcgacagcatgctttcggggctcttcggcgatgccgcgcgc
cctgatgatgaccggcccgcgcttggcgttcccatgctggcgcactggctgccctatcgc
agctacgatcccaagacggggatcttctacaacagcgcctcgcgcggattcgtgatcgag
gccgctccgatggtgggcgcggacgagcgcaccgcggagatcatcacgcagttcctgtcc
gaaggcattcccgcgccgggctgcatccagttccatcagtggatgagcccgcgcgtgggg
gaggcgctgagcaaatggtatctgccgcgctatgccgcacgcggcgtctacgaacggatg
gccaagcaccgggtcgatttcctcagcgacggcgtatggcagtcgctctcgaaggacgcg
cccttttgcctgcgccatcaccgcgtggcgatctcctattcgacgcccgagagctcgtcg
gtgtccgatgacgacatcgtctcggtcatggaggggctcgtctccgcgctggcttcggtg
gggatcacgacccggcgcatggatccggtcgcgctgatcgcctggatcgacgacatcact
tcaccgaccacggctgccggtgaggacgtcgtcagctacaatcccttcgatccaatcgcc
gaccaggccattcgccgcgacatcgagctccgggtcgaacccgaccggatgctgctgcgc
accgagcggttccgaccgaccggcaaggtccacgaaggcgccccggagatcggcgagatc
tatcccgatgtctttgacgtgcgctccttctcggtgcgcaacctgcccaatcgctgggcg
ccctgggacatggcgaagctggtgggcgacatgttcactgacaagctgcgcatgccgtgc
ccggtcgcgacgaacctgtgcgttgaatatccggacacccaggcctcgtcgaacaaggcg
agcttcaagttcatgcggacgacgagtctcgccgattccaagtccgcgcgtttcctgccg
cagctgcgcgaccagagccaggagtggcggttcgtcaacgacgagatccggcagggccgc
aaacttgtgcgggtattcttttccgtcacctccttctcgcccaagggacgcggcgacgcc
aacgaacgtgtgctcaaatccgtctaccgcgcggcgggctgggacctgctcgacgaccgc
tacctgcaggtgatgggcctgctctgcgccatgcccatgacgatggccaacggcctgtcg
cgcgatctcgagcggatgaagcgcatgcgcacgctgctcaccaccaccgccgccaatctc
gcgccgctgcagggcgaatatctaggcggccatgtgccgcatctcctgatggtgggacgg
cgcggccagcccttcttctggtcacccttcgaaaacgcggcgggcaaccataatgtcgcg
gtcttcggcaaatcgggatcgggcaagtcggtggccttgcaggagctgtgcgcctcgctg
tgcggcgctggcgcaaaggtggtcgtgatcgacgacgggcgatcgttcgagcattcggcc
aaattgcagggcggcgccttcgtcgaattcaccatgagctcgggcttctgccttaatccc
ttctcgatgatcgacgaggcccaggcggctgaggacgaggactatctgctcgactgcatg
gcgatgctcaaggccatcgtgaaccagatgtcgcgccacatcgaccgtctcaacgatacc
gagcgcggcctcatcgatggcgcggtcaacacggtgtgggaggcacacggccgaagagga
tcgatcgaccttgtgatcgaggcgctcgatgcaaccggcaacgcgctcgcgcacgacctc
ggtattgcgatgcgccccttctcggcggcgggcacctatggccggttcttccagggggag
gtcagcttcgaactgaaggcgcagctcacggtcttcgagctctcggatctctccgcgcgc
gaagaactgcgcagcgtggtcctcaccgccatcatgttcatgtcgcagcaggtgatgcgc
aaggtcgatcgcgcaatccccaaggcactgctgctggatgaagcctggcagctgctgcgc
ggcggggctatggccgacttcatcgagacctatgcgcgcacctgccgcaaatatggcgct
tcgctcgtcaccgccacgcagtcgctcaacgattattacaagtcggcgggttcgatcgcg
gcgctggagaacagcgactggttcgtcatcctgcagcagaagccggaaacgatcgccgac
ttcaagaagcatgatcgcttcgagatggacgattataccgatgcgctgctgcgctccttg
aagcgtaacggcttcgaatattcggacatcatgatcaagggacccgagacgctggcggtt
ggtcgcctggttctggatccctattcagccacattgttttcctcgagcccgcagaccttc
gcccggatcgaggcgctgatcggagagggtctcagcatggacgaggcgatcgagcgcatc
gcctttcccgacaaccccgagaaatgggcggcgaacgcggagagtgatcccgacgtcgca
atcgccgcggagtag

DBGET integrated database retrieval system