KEGG   Syntrophomonas wolfei: Swol_1048
Entry
Swol_1048         CDS       T00396                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00620  Pyruvate metabolism
swo00640  Propanoate metabolism
swo00650  Butanoate metabolism
swo01100  Metabolic pathways
swo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swol_1048
   00640 Propanoate metabolism
    Swol_1048
   00650 Butanoate metabolism
    Swol_1048
Enzymes [BR:swo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Swol_1048
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABI68360
UniProt: Q0AY44
Position
1193814..1196042
AA seq 742 aa
MQAAWSGFKAGRWMHEIDVRDFIQKNYSPYDGDSGFLTGPGEKTSLLWRKCQDLLQKERE
SKGVLLVDADTPLSITSHPPGYIDRELEKIIGLQTDKALKRAINVYGGLKMTLNACRAYG
YEPDKKLLKFFEKHRRTHNDGVFAVYTPEMRLARKVGIITGLPDSYGRGRIIGDCRRVSL
YGVDFLIKAKENDRDWLNRRMTPELIQLREDMAGQIKSLQDLKQMAKSYDYDISRPAATA
VEAVQHLYFAYLAAVKEQNGAAMSLGRVSTFLDIYLERDLRLGRITENEAQELIDQLVIK
LRLVRHLRTPEYSEIFAGDPNWVTESLGGSGTDGRHLVSKTSYRFLQTLKNLGAAPEPNM
TILWSRNLPRNFLEFCAKLSISTSALQYENDDLMRDYYGDDYGIACCVSAMRLGKETQLF
GARCNLAKLLLYAINGGKDEISGQQVGVEMSVYDGDRLEFGEVMRRFKIQMEWLAELYVN
TMNLIHYMHDKYAYEYVQMALHNTFVKHFMAFGIAGLSVAADSLSAIKYAKVRPIKDERG
LVSDFAIEGEFPKFGNDDDRVDLLAVEIIHTFIHQLKRHPAYRDAQHTLSILTITSNVMY
GKYTGTTPDGRQKGEPLAPGANPLHGREEKGAIAACNSVAKLPYEDARDGISFTFSTVPE
ALGKSKEERVNNLLALLEGYFVQDAHHMNVNVLNVETLKEAMEHPEKYPDLTIRVSGYAV
HFTKLNREQQEEIIMRTFYRRM
NT seq 2229 nt   +upstreamnt  +downstreamnt
ttgcaggcggcatggagcggttttaaagcaggcagatggatgcatgaaatagatgtaagg
gactttatccaaaaaaactatagcccctatgatggcgatagtggttttttgactggcccg
ggagaaaaaacatctttgctctggagaaaatgccaggatttattgcaaaaggaaagggaa
tctaaaggggttttgctggtagatgcggatactcccctaagcattaccagccatcccccg
ggttatattgaccgggaactggagaagattatcggtttgcaaacggataaggccttgaaa
cgggctatcaatgtttacggtggtttgaaaatgaccctcaacgcttgccgggcgtatggt
tatgaaccggataagaagctcctgaagttttttgaaaaacaccgccgtacccataatgac
ggagtttttgcggtctataccccggaaatgcgcctggcgcgaaaggtggggataattacc
ggtctgccggactcttatggccgtggccggataattggcgattgtcgccgggtaagtctt
tatggagtagattttctcataaaagccaaagagaacgaccgcgattggcttaatcgtaga
atgactcccgagctcatacaactccgggaagatatggcgggacagattaagtctctgcaa
gacctgaagcaaatggctaaatcttatgattatgatatttcccgaccggcagctactgcg
gttgaggcagtgcagcatctctactttgcctacctggccgcagtcaaggaacaaaacgga
gctgccatgagcctggggcgggtctccacctttctcgacatctatctggaacgggacttg
cgattaggaaggattacggagaacgaagcccaggaattgattgatcaattggtgataaaa
ctacgactggttcggcacttgcgcacccccgagtacagtgaaatatttgccggggatccg
aactgggtcacggaatcactgggcggctccggtacggacgggaggcatctggttagcaaa
acttcttaccgctttctacagaccttgaaaaatttaggagcggcacctgaacccaatatg
actattttatggtcacgcaatcttcctcgcaattttttagagttctgcgctaagctgtct
atttctacatctgctctccagtacgagaacgatgacctgatgcgtgactactatggtgat
gattacggtatcgcttgctgtgtatcggctatgcgcctggggaaggagactcagcttttt
ggcgcccgctgcaacctggccaaacttttactctatgccataaatgggggcaaggacgag
ataagcggccaacaggtaggggtggaaatgtcggtttatgatggagatagattggaattt
ggcgaggttatgagacgattcaagatacagatggaatggttagctgagctttatgtaaat
actatgaatcttattcattatatgcatgataagtatgcttatgaatatgtgcaaatggcc
ttgcacaatacttttgtcaaacactttatggcttttggcatagctggtttatcagttgca
gctgattctctaagtgcaataaaatatgctaaggtaaggcccatcaaagacgaaagggga
ttggtcagcgattttgccatagaaggtgaattccccaagtttggtaatgacgatgaccgg
gttgacctgttggcggtggaaataattcatacctttatacaccagcttaagcgccaccct
gcttatagagatgcccagcataccttgtccatattaaccataacctctaatgtaatgtat
gggaaatataccggaaccactccagatggacgacaaaaaggcgagcctctggctcccggt
gccaaccccttgcacggccgggaagaaaagggagctatagccgcctgtaattcggtagcc
aaattaccctatgaagatgcccgagacggcatttctttcaccttctctactgtccctgaa
gcccttggtaaaagtaaggaggaacgggtaaacaatctattggctctgcttgaaggctat
ttcgttcaggatgctcatcatatgaatgtaaatgttcttaatgtagaaacattgaaggaa
gctatggagcacccggaaaaatacccggacctgaccatccgggtctctggttatgcagtg
cattttaccaaactaaaccgggagcaacaggaagagataattatgcgtaccttctatcgc
cgaatgtag

DBGET integrated database retrieval system