KEGG   Syntrophomonas wolfei: Swol_0308Help
Entry
Swol_0308         CDS       T00396                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00071  Fatty acid degradation
swo00280  Valine, leucine and isoleucine degradation
swo00362  Benzoate degradation
swo00620  Pyruvate metabolism
swo00630  Glyoxylate and dicarboxylate metabolism
swo00640  Propanoate metabolism
swo00650  Butanoate metabolism
swo00900  Terpenoid backbone biosynthesis
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01120  Microbial metabolism in diverse environments
swo01130  Biosynthesis of antibiotics
swo01200  Carbon metabolism
swo01212  Fatty acid metabolism
swo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Swol_0308
   00630 Glyoxylate and dicarboxylate metabolism
    Swol_0308
   00640 Propanoate metabolism
    Swol_0308
   00650 Butanoate metabolism
    Swol_0308
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Swol_0308
   00072 Synthesis and degradation of ketone bodies
    Swol_0308
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swol_0308
   00310 Lysine degradation
    Swol_0308
   00380 Tryptophan metabolism
    Swol_0308
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Swol_0308
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Swol_0308
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Swol_0308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swo04147]
    Swol_0308
Enzymes [BR:swo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Swol_0308
Exosome [BR:swo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Swol_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABI67651
UniProt: Q0B053
Position
369952..371160
Genome map
AA seq 402 aa AA seqDB search
MGLNEVVMVSACRTPIGKFLGQFKDVPAKDLAVTAGKEAIKRAGIPADIIDEIVMGQVYQ
GLQKSLPARIVGLACGLPERSNACVVNQNCTSSMRALEIASRNIMLGVTDIALVVGVENM
TQAPYMVPSARTGARMGDAKQIDSLTHDALVDSLVPGHMGMTAENVAVMYNITREQCDEL
AVRSHTNAINATDNGIFKREIVPVEVKTKKGITIIETDEHPIRGSSMESVGRLKPAFKKD
GGVVTAANASGINDGASAAVIMSKQKAAELGITPLMKLVASVGVGVDPQIMGIGPAEAIP
VALEKAGWKFDDVDYWELHEAFAPQFIGCKIRLKEKYGMDLSMDKVNHNGSGIALGHPIG
SSGLRIVVSLYYELERLGLTKGGASTCVGTGPAMASLWTRDI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgaatgaagttgtaatggtaagtgcttgtagaactcctataggcaagtttctg
ggccagtttaaagatgtaccggccaaggatttggcagtaacagcaggtaaggaagccatc
aagagagctgggatcccagctgatattattgatgaaattgtaatgggtcaagtttatcag
ggcttacagaaatctttgcccgcacgtattgttggtttggcctgcgggcttcctgagcgt
agtaatgcttgtgttgtaaatcagaattgtacctctagcatgagggcgttggaaattgcc
agtcgcaacattatgctgggagtgacagatatcgcgctggttgtcggtgtggaaaacatg
acccaggcaccttatatggttcccagtgccagaaccggggccagaatgggcgatgccaaa
cagatcgattcgttaacccatgatgcattggttgattcattggttccgggacatatggga
atgactgctgaaaatgttgcagttatgtataacattactcgcgaacagtgtgatgaatta
gcggtcaggagccataccaatgccataaatgcaacggataatggtattttcaagagagaa
atcgtcccggttgaagttaaaactaaaaaaggtataacaattattgaaacagatgaacat
cctatccgtggttccagtatggaaagcgtgggcaggctaaaaccagcatttaaaaaagat
gggggtgtagtaaccgctgctaatgcatccggcatcaatgacggcgcttccgctgctgtt
ataatgtccaaacaaaaagctgcggaactgggaataacaccgcttatgaaattggttgct
tcagttggtgttggggttgatccccaaatcatgggaatcgggcctgcggaagcaattccg
gtagcactcgaaaaagctggttggaaattcgatgatgttgattattgggaactgcatgaa
gcgtttgcacctcagttcataggctgcaaaattcgcctgaaagaaaaatatggcatggac
ctctctatggataaagtaaatcacaatggatcaggtattgctttgggacatcctattggc
tcaagcggactgcgtatcgtggtttctttatactacgaactggaaagactcggccttacc
aaaggcggcgcctctacttgtgtaggaaccggaccggccatggcctctttgtggactcgc
gatatttaa

DBGET integrated database retrieval system