KEGG   Syntrophomonas wolfei: Swol_0788Help
Entry
Swol_0788         CDS       T00396                                 

Definition
(GenBank) Butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00071  Fatty acid degradation
swo00280  Valine, leucine and isoleucine degradation
swo00410  beta-Alanine metabolism
swo00640  Propanoate metabolism
swo00650  Butanoate metabolism
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01120  Microbial metabolism in diverse environments
swo01130  Biosynthesis of antibiotics
swo01200  Carbon metabolism
swo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Swol_0788
   00650 Butanoate metabolism
    Swol_0788
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Swol_0788
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Swol_0788
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Swol_0788
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Swol_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ABI68109
UniProt: Q0AYU5
Position
complement(897726..898868)
Genome map
AA seq 380 aa AA seqDB search
MDFRLNEEQEMMKKMAHDFAVNEIAPYASEWDNNHIYPEDCIKKMHEVGLMTIGVPAEYG
GAGLDHTAQNIVAEEICWGDAGVGTVMVASTLLASDPVLVAANHEQKKEFYGRLLDGELA
AFCLTEPGAGSDAGGIATRCVKSGDEYILNGSKQFISNGGTAGVYTVLATLDKKMGTKGM
CAFIVDRNTPGITVGKTEDKLGIRTSNTTEVIFEDVRVPAKNLLGTEGQGFYIIMKTLDL
SRASIAAMATGVSQACLDASLEYSKLRTQFGKPICSFQAIQFKLADMAMRIEASRLLYLE
ASSLQDMNVPRFSKAASLAKAYAGDTAVFCATEAVQVFGGYGYTKDYPVEKYYRDAKIFQ
IYEGTGEVQRLVIAGDLLRG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggatttccgtttaaatgaagaacaagaaatgatgaaaaaaatggcccatgattttgcg
gtcaatgagatagcaccctatgcctccgagtgggataacaaccacatttatcccgaagac
tgcattaaaaagatgcacgaagtaggactgatgaccatcggcgtaccagcggaatatggc
ggagccggcctcgatcataccgcccagaacattgtcgctgaagaaatctgctggggtgat
gccggcgtaggtaccgtcatggtagccagcaccctattggcgtccgaccccgttctggta
gccgccaatcacgagcagaaaaaagagttttatggacgcttgctggatggcgaactggca
gcattctgtttgaccgagcccggtgccggttccgatgccggtggcattgccacccgctgt
gtcaaaagcggcgatgagtatattctaaacggcagcaaacagttcatcagcaatggcgga
accgccggcgtttataccgtactggccaccctggataagaagatgggtaccaaaggtatg
tgtgcctttattgttgaccgcaatacccccggtataaccgtaggcaaaaccgaagacaaa
ctgggaatcagaacttccaacaccactgaagtaatatttgaagatgtccgggttccggcc
aagaatcttttgggcaccgaaggacagggcttctatatcataatgaagactttggacctt
tcccgggccagcattgccgccatggccaccggcgtatcccaagcctgtctggacgcttcg
ttggagtattccaaattgcgcacccagtttggcaaacccatatgcagcttccaggccatt
cagttcaagctggcggatatggccatgaggattgaagcctcccgcctgctctatctggaa
gcctcctcactgcaggatatgaatgttccccgtttcagcaaagccgcctccctggccaaa
gcctatgctggtgataccgccgtattctgcgccaccgaagcggtgcaggttttcggcgga
tatggctataccaaggactacccggtagaaaaatactaccgtgacgccaagatattccag
atatacgaaggaaccggcgaggttcagagactggtaatcgccggagacttgctcagaggt
taa

DBGET integrated database retrieval system