KEGG   Syntrophomonas wolfei: Swol_0906Help
Entry
Swol_0906         CDS       T00396                                 

Definition
(GenBank) Polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
swo  Syntrophomonas wolfei
Pathway
swo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:swo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Swol_0906
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:swo03019]
    Swol_0906
   03016 Transfer RNA biogenesis [BR:swo03016]
    Swol_0906
Enzymes [BR:swo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     Swol_0906
Messenger RNA biogenesis [BR:swo03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Swol_0906
Transfer RNA biogenesis [BR:swo03016]
 Prokaryotic type
  tRNA degradation factors
   Swol_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH RNase_PH_C S1 KH_1 PNPase
Motif
Other DBs
NCBI-ProteinID: ABI68222
UniProt: Q0AYI2
Position
1025311..1027422
Genome map
AA seq 703 aa AA seqDB search
MIVKKYQMEVAGRPLIVEIGQVAQQANGAALMRYGDTVVLVTATAAKQPREGIDFFPLTV
DYEEKQYAVGKIPGGFIKREGRATAQATLSARLIDRPIRPLFPKGFRNEIHVVATILSVE
KDNAPDVTAITGASVALSISDIPFAGPVAAVIVGLVDGELIINPTVEQHQKSDLHLAVAG
TKEAIMMVEGGANEVPEETMRDAIFFAHEEIKKIVDFQENIIREVGLSKMQVEIPILDEE
IKKAVVEFATPLFEEAVKNPDKKTREDQMDSSQKSVLQHFTESYPEEEKLIADVSDETMK
AVVRKMALEEGERVDGRKLDEIRKVSCEVGFLPRPHGSGLFTRGQTQVLSVTTLGAISEE
QRLDGLGIEEKKRYIHHYNFPPYSTGETKPMRGPGRREIGHGALAERALLAVIPSEEEFP
YTIRVVSEVLESNGSSSMGSVCGSTLSLMHAGVPIKAPVSGIAMGLVKEGERFAIMSDIQ
GIEDALGDMDFKLAGTEKGVTALQMDIKITGVNREIVEAALKQAREGRMFILKKMLEAID
KPNEELSPYAPQMIRMQIDPDKIREVIGPGGKTIHKIVDETGCKIDIEDDGSLFIMATDE
EAAKKARFFVESIVAEVEVGKTYMGTVKRIMDFGAFVEIIPGVLGTSGKEGLVHISQLAE
ERVNKVRDVVDIGDQILVKVTEIDRQGRVNLSRKAVLKSAVKK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgatagttaagaagtatcaaatggaggtagcagggcgaccattaattgtggaaatagga
caagttgcccagcaggccaatggagctgctcttatgagatatggcgatacagttgtattg
gtcacagctacagctgccaaacagccccgcgaaggaattgactttttcccgctaacggtt
gattacgaggagaaacaatatgcggtagggaaaataccaggaggtttcattaaaagagaa
ggccgggctacagcccaggctaccctatctgctcgcttgattgaccggcctatccgccca
cttttccctaaaggtttccggaatgaaatacatgtagtagccactattctatcggtggag
aaagataatgcaccagatgttaccgctataaccggagcctctgttgccctttctatttct
gatataccttttgctggtccagtagcggcagtaatagtgggactggtggatggggaactg
attattaatcctacagtggagcaacaccagaaaagcgatctacacctggcggtagcggga
accaaagaggctatcatgatggttgaaggaggagccaatgaggttcctgaggaaactatg
cgtgatgctattttctttgctcatgaagagattaagaaaatagtagattttcaggaaaat
atcataagagaagttggcctgtccaaaatgcaggtggaaattccgattttggatgaggaa
ataaaaaaggccgttgtcgaatttgctactccactatttgaagaagcggtcaagaatcca
gataagaagacgagggaagaccagatggattcctcccagaaatctgttttgcagcacttt
accgagagctatccggaagaagaaaaattgattgccgatgtatcggacgagaccatgaaa
gccgtggttagaaagatggctctggaggaaggggaacgggttgatgggagaaagcttgat
gaaatcaggaaagtaagctgcgaggttggtttcctgccccggcctcatggctcaggtctt
tttacccgcggtcagacccaggttttgtcggttaccaccctgggagccatcagtgaagaa
caacggcttgatggtctgggaatcgaagagaaaaaaagatatattcatcactataatttc
cctccctatagcactggtgaaaccaaacctatgcgtggtccgggaagaagggaaattggt
cacggagccctggctgaacgggctttgctggcagtaataccatcggaagaagaattccct
tatactataagggtagtttctgaagttttggaatcaaatggctccagctctatggggagt
gtatgtggtagtacgctatctctgatgcacgccggtgttcccattaaagctccggtatct
ggtattgccatgggactggtcaaagaaggcgagcgttttgccattatgagtgatattcag
ggaatagaggatgctctaggagacatggatttcaaactggctggaaccgaaaaaggggtt
accgccctgcagatggacataaaaattaccggggttaaccgtgaaatagtcgaagctgca
cttaaacaggcccgtgaaggcagaatgtttatcttaaagaagatgctcgaagccatcgat
aagcctaatgaggaactttctccttatgccccgcagatgatccgtatgcagatagacccg
gacaaaatccgggaagttattggacctggcggcaaaaccattcataaaatagtcgatgag
accggttgcaaaattgatattgaagatgatggtagcctgtttataatggctacagatgaa
gaggccgcgaaaaaggcccgattttttgtggaatccattgtggctgaagttgaggtgggc
aagacctacatgggaaccgttaagcgcataatggattttggggcttttgtggaaatcatt
cccggggtattgggaacatcaggaaaagaaggcctggtacacatttcccagctggccgag
gaaagagtaaacaaagtcagagatgtggtggacatcggggatcagatactggtcaaggtt
acagaaattgatagacaaggccgggtaaacctttcccgtaaagctgtattaaaaagcgct
gttaaaaaataa

DBGET integrated database retrieval system