KEGG   Syntrophomonas wolfei: Swol_1375Help
Entry
Swol_1375         CDS       T00396                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00010  Glycolysis / Gluconeogenesis
swo00020  Citrate cycle (TCA cycle)
swo00620  Pyruvate metabolism
swo00640  Propanoate metabolism
swo00650  Butanoate metabolism
swo00680  Methane metabolism
swo01100  Metabolic pathways
swo01120  Microbial metabolism in diverse environments
swo01130  Biosynthesis of antibiotics
swo01200  Carbon metabolism
Module
swo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Swol_1375
   00020 Citrate cycle (TCA cycle)
    Swol_1375
   00620 Pyruvate metabolism
    Swol_1375
   00640 Propanoate metabolism
    Swol_1375
   00650 Butanoate metabolism
    Swol_1375
  Energy metabolism
   00680 Methane metabolism
    Swol_1375
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Swol_1375
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Swol_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABI68682
UniProt: Q0AX72
Position
complement(1590717..1591910)
Genome map
AA seq 397 aa AA seqDB search
MSSRLSGNEAVAYAMKQINPDVMGAFPITPSTEIPEYFAAYVANGEVNTEYVAVESEHSS
MSVCIAAQAAGARAVSATSSCGLALMYELLYVAASCRLPITLACVNRALSGPININHDYS
DSMGARDSGWIQIYAENNQEAYDNIIMAMPIGETPNIRLPVMSCMDGFITSHAVENIELL
ETDVVRKFIGEYNPEHYLLKKENPLAVGPYDVSAYYMEHKVQEAEAMKAAKSRILEVAAE
FEKISGRRYGLFEEYRMEDAQLALVLIGSTAGTAKAAINKLRENGIKAGLVKIRVFRPFP
GEELARALAGTRAVAVMDKSEGFSANGGPLFAETRSALYDLKERPYMINIVYGLGGRDVK
TEDIEKVFGRLADIARTGETHPVYTHMGQRSREEETA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccgtctttccggcaacgaggctgtagcttatgccatgaagcagataaatcct
gatgtcatgggagctttccctatcactccctccacagaaattcctgaatacttcgctgct
tatgtagccaacggcgaggtgaatactgaatatgtagccgtggagtccgagcatagttcg
atgtccgtgtgcattgcggcacaagcagcaggagccagagccgttagtgctacttcatcc
tgtggactggccctgatgtacgagcttttgtatgtggcggcttcatgccgcttgccgatt
accctggcctgtgtcaaccgggctctttcggggccaattaacataaaccacgactactcc
gattcaatgggagcccgtgatagcggctggattcaaatctacgctgagaataatcaggag
gcctacgataatattataatggctatgcctatcggcgagaccccgaacatacgcttgccg
gtgatgagctgtatggatggtttcattaccagtcatgccgtagagaatatagagcttttg
gaaacggatgtggtgcgtaagttcatcggggaatacaaccctgaacattacctgctcaaa
aaagaaaatccgctggcggtaggaccatatgatgtgagtgcctattacatggaacataag
gttcaggaggctgaggccatgaaggcggccaagtcccgcatactggaggtagccgcagag
tttgaaaagatttccggccggcgctacggcttgtttgaagaatataggatggaggatgcc
cagctggctctggttctaatcggttccactgcgggaacggctaaagcagcgatcaacaag
ttgcgggaaaatggaataaaggcagggctggttaaaatcagagttttccgtcctttcccc
ggcgaggaactggcccgagcgttggcgggcaccagggctgtagccgttatggataagtcc
gagggtttttcggccaacggcggtcctttatttgccgagacccgcagcgctttatatgat
cttaaggaacgcccctatatgattaatattgtttacggtctgggtggccgtgacgtaaag
accgaggatattgaaaaagtcttcggccggctggcggatattgctaggaccggtgaaacc
cacccggtatatacccatatgggacagaggtcaagagaggaggagacagcatga

DBGET integrated database retrieval system