KEGG   Syntrophomonas wolfei: Swol_1408Help
Entry
Swol_1408         CDS       T00396                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00790  Folate biosynthesis
swo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swol_1408
Enzymes [BR:swo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Swol_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABI68715
UniProt: Q0AX39
Position
1621403..1621981
Genome map
AA seq 192 aa AA seqDB search
MQKKVIDEAKIEEAVHMILEAIGEDPEREGLQNTPKRVARMYREIFAGMNSNPREFLQVS
FTEFHDELVLVKDIPLYSMCEHHLLPFYGKAHVAYIPRGGKVVGISKLTRVAEAYAMRPQ
LQERLTSQIADCINDSLKPFGVAVVIEAEHMCMTMRGVRKPGALTVTSAVRGIFETRPET
RAEVFSLINQKI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaagtaatagatgaagccaaaattgaagaagctgttcacatgatactggaa
gcaattggggaagacccggaacgggaaggcttgcaaaacaccccgaaaagggtagctcgc
atgtatagagagatatttgccggtatgaattctaaccccagggaattcctgcaggtttcc
tttacagaatttcatgatgaactggtattggtaaaggatattcccttgtattcgatgtgt
gaacaccacttgcttcccttttatggcaaagctcatgtagcctacatcccccgcggtggt
aaagtggtgggaataagcaagttgacccgggtggcagaagcctatgccatgcgcccccag
ttgcaggaaagacttacttcccaaatagccgactgtataaacgatagcttaaagcctttt
ggggtggcagtagtaatcgaagcggaacacatgtgcatgaccatgagaggtgtacgcaag
ccgggagccttaactgtaacctctgccgttcgtggaatttttgagaccaggcctgaaacc
agggctgaagtcttctctcttattaaccagaaaatctaa

DBGET integrated database retrieval system