KEGG   Syntrophomonas wolfei: Swol_1768Help
Entry
Swol_1768         CDS       T00396                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00340  Histidine metabolism
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:swo00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Swol_1768
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Swol_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh RHH_1
Motif
Other DBs
NCBI-ProteinID: ABI69066
UniProt: Q0AW38
Position
complement(2021286..2022584)
Genome map
AA seq 432 aa AA seqDB search
MNIKKFDGASEDFKRFLAASNASMKQYEDSVGEIGRQVQEKGNQAIFAFTLKFDGAKIDE
SNFLVSEDEIEAAYDEVDDDYIFALDQAIDNIATFHSRQLKNSWMEPDERGNILGQLYRP
LERVGIYVPGGTAAYPSSVLMNAIPAQVAGVSEIAMVTPPAKDGSINPYTLVAAAELGIE
EIYKMGGAQAVFALAYGTETINKVDLISGPGNIYVTIAKKMVYGDVNIDMLAGPSEILIV
ADKKANPAYLAADMMSQAEHDVLARSILVTDSETLIERVQEEIEKQVQELSRQDIIRQAL
ENYGALVLVPQMDQACAVANLVAPEHLELMVEHPFDYLSRIRNAGAIFLGKDTPEPVGDY
FAGPNHILPTGGTARFYSPVSVDTFMKSSSIIYYSPQGIKEDAEGIMKLAEVEGLTAHAN
SIRIRVKGKKKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaagaaatttgacggagcttcagaggattttaagcgttttttagccgccagt
aatgccagtatgaaacaatacgaagatagcgtaggagagattggccggcaggtgcaagag
aaaggtaaccaggctatatttgcctttaccttaaagtttgatggagcaaaaatcgatgaa
agcaacttcctggtttctgaagatgagattgaggcggcttatgatgaagttgatgatgat
tacatatttgctctggatcaggctatagataatatcgctacttttcatagcaggcagttg
aagaactcctggatggaaccagatgagcgcggcaatatactgggacagctttaccggcct
ttggaaagggtgggtatatatgtacccggcggaactgcggcctacccctcgtcagtactt
atgaatgccattccggcccaggtagccggggtaagcgaaatagccatggtgactccacca
gctaaagacggttccataaatccctatactttggtagcggcagctgaactgggaatcgag
gagatatataagatgggcggcgcccaggccgtattcgctctggcctatggtacggagact
attaataaagtggacttgataagcggccccggcaatatctatgttactatcgctaaaaaa
atggtttatggtgatgtgaacatcgatatgctggctggtcccagtgaaatactgatagtt
gctgataagaaagccaacccggcttatctggcagcggatatgatgtcccaggcggaacat
gatgtgctggctcgcagcatactggtgaccgacagtgagaccttgattgagcgggtacag
gaggaaatcgagaagcaggtgcaggaactttcccgccaggatattattcggcaggccctg
gagaattacggggccttggtactggttccccaaatggatcaggcctgtgcagtggctaac
ctggtggcccctgaacacctggaattgatggtagagcatccttttgattacttgagccgg
attcgcaatgccggggctattttcctggggaaagataccccggaaccggtgggggattat
tttgccggccccaaccacatattgcccaccggtggaaccgctcgtttttattccccagtc
agcgtagacacctttatgaagagttccagcatcatttattattccccgcaaggaataaag
gaagatgccgagggaataatgaagctggctgaggtggaagggcttactgcccatgccaat
tccataagaataagagtaaagggaaaaaagaaaaaatag

DBGET integrated database retrieval system