KEGG   Syntrophomonas wolfei: Swol_1860
Entry
Swol_1860         CDS       T00396                                 

Definition
(GenBank) GTP cyclohydrolase subunit MoaA
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00790  Folate biosynthesis
swo01100  Metabolic pathways
swo04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Swol_1860
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Swol_1860
Enzymes [BR:swo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     Swol_1860
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14 CMD
Other DBs
NCBI-ProteinID: ABI69158
UniProt: Q0AVU6
Position
complement(2124833..2125813)
AA seq 326 aa
MLDKHERNINYMRISLTDRCNLRCRYCMPETGVDNLTHYSILSLEEMARLVRIASELGIQ
KIRLTGGEPLVRRNVPQLISYIAQIPRIDDIALTTNGTLFAALAEELKTAGLNRINFSLD
SLVPEKFKYITRRGDLSKVKEAIFKALELDMHPVKINMVVIRGFNDDEIIDFVELARKYP
LHVRFIEFMPVGDLLFWKKDRMMPAQDIKAYIEESYVLTPQKNILGNGPARYYSLEGGEG
SLGFISPMSNHFCGECNRIRLTAEGGLRGCLYDKREVNLKTALKNGSSDEEIKELFIWAI
KAKPARHHMNNGWGEENKRKMYQIGG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgctggataaacacgaaagaaatataaactatatgcgaatttcccttaccgacaggtgt
aatttgcgttgccgctattgtatgcctgagaccggtgtcgataacctgacccattattcc
attctaagcctggaggaaatggccaggttggttcggatagccagtgagttaggaatacaa
aaaatacggctgactggaggagaaccgctggttcgtaggaacgtaccccaattgattagt
tatattgctcaaattcctcgtatcgatgatattgctttgaccaccaatgggacattattt
gctgctttggccgaggaacttaagacagcgggtttaaaccggattaactttagcctggat
agcttggttccagaaaaattcaaatatattacgcgccggggagatttatccaaggtaaaa
gaggctattttcaaagccctggaacttgatatgcatccggtaaagattaacatggtagtt
attagaggttttaatgatgatgaaattattgattttgtagaactggctcgaaaatatcct
ttgcatgtacgctttatcgaatttatgcccgtgggtgacctgttgttctggaaaaaggat
cggatgatgcctgcacaggatattaaagcttatattgaggaaagctatgttctgactccg
caaaagaatatcctaggcaatggaccggccaggtattacagcctggaaggcggagaaggg
tcactcggttttatcagtcccatgagcaaccatttttgtggtgagtgcaatcgcatccgc
ttgacggctgaaggtggtctcagaggatgcctttatgacaaacgggaggttaacttgaaa
acggcccttaaaaatggttccagcgatgaagagataaaggaactttttatttgggccatt
aaagccaaaccagctcggcatcatatgaataatggctggggagaggaaaacaagcgcaag
atgtatcaaatcggaggataa

DBGET integrated database retrieval system