KEGG   Syntrophomonas wolfei: Swol_2144
Entry
Swol_2144         CDS       T00396                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00290  Valine, leucine and isoleucine biosynthesis
swo00770  Pantothenate and CoA biosynthesis
swo01100  Metabolic pathways
swo01110  Biosynthesis of secondary metabolites
swo01210  2-Oxocarboxylic acid metabolism
swo01230  Biosynthesis of amino acids
Module
swo_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:swo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Swol_2144
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Swol_2144
Enzymes [BR:swo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Swol_2144
SSDB
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C F420_oxidored NAD_binding_2 AdoHcyase_NAD NAD_binding_7 ApbA
Other DBs
NCBI-ProteinID: ABI69435
UniProt: Q0AV19
Position
complement(2463481..2464494)
AA seq 337 aa
MARMFYDADANLENLKGKTIAVMGFGSQGHAQAQNLKESGLNVIVGLRKPFDEASEKEWN
AVIAAGITPMSVAEAAEAADVIQILLPDEVQARVYNAEIKPYLKAGNALGFSHGFNIHFG
QIVPPAFVDVFMVAPKSPGHLVRRMYVKGAGVPGLVAVQQDYSGKAKDLALAYACGIGCT
RAGVIETSFQEETETDLFGEQCVLCGGVTELVKAGFETLVEAGYQPEIAYFECMHELKLI
VDLMYEGGMSYMRYSISDTAEWGDYTKGPEIIGEEARYAMYEALQDIQDGSFAKGWLLEN
MVGRPRFNALKRQNREHLIEEVGAELRGMMPWLKETK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggctagaatgttttatgatgcagatgccaatctggagaatctgaagggaaagaccata
gcagttatgggatttggttcccagggacacgcccaggcccagaaccttaaagagagtgga
cttaatgtcatagtgggccttaggaaaccttttgacgaagccagcgaaaaagaatggaat
gccgtaatcgccgccggaataaccccgatgagtgtggcggaagcggcggaagctgcggat
gtaatccagatactgctcccggatgaagtgcaggcccgggtctataatgcggaaatcaag
ccttaccttaaagcaggaaatgccctgggcttttcccacggatttaatattcactttgga
cagattgtacccccggcttttgtggatgtatttatggtagcccccaaaagccccgggcac
ctggtacgccgtatgtatgtaaaaggggccggagttcccggactggtagcagtgcagcag
gattatagcggaaaagcaaaagacctggctctggcctatgcttgcggcattggctgtacc
cgagccggagtaattgaaaccagtttccaggaagaaaccgagaccgatctgtttggtgaa
caatgcgttctctgcggcggggtaactgaactggtaaaagccggatttgagaccctggtg
gaagcgggttaccaaccggaaattgcctattttgagtgcatgcacgagcttaagcttatt
gtggatttgatgtatgaaggcggtatgagctatatgcgttattccatcagcgataccgct
gagtggggggattataccaagggaccggaaattatcggggaagaagcaagatacgccatg
tatgaagccttacaggacattcaggatggcagttttgccaagggttggctgctggagaac
atggtgggtcgtcctcgtttcaatgccctgaaaagacaaaaccgggaacacttgattgaa
gaagtcggagccgagctgcggggtatgatgccctggctgaaagagactaaatag

DBGET integrated database retrieval system