KEGG   Syntrophomonas wolfei: Swol_2328Help
Entry
Swol_2328         CDS       T00396                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
swo  Syntrophomonas wolfei
Pathway
swo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:swo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Swol_2328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:swo03011]
    Swol_2328
Ribosome [BR:swo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Swol_2328
  Bacteria
    Swol_2328
  Archaea
    Swol_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABI69619
UniProt: Q0AUI5
Position
complement(2661642..2661983)
Genome map
AA seq 113 aa AA seqDB search
MEARAIARYIRVSPFKARQVADLVRGKDTEEAMAILRYTNKKSAPLIRKVLQSAIANAEH
NFDMDSNALVVSQIFIDEGPIVKRMRPRAYGRADVRRHRTSHITVVLREREVK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagccagagctattgctcgttatattcgcgtatctccttttaaagcccggcaggta
gcggatctggttagaggcaaggatactgaagaagccatggcgattttgaggtataccaat
aagaaatcggctcccctgataaggaaagtactgcagtctgctatcgccaatgctgaacac
aattttgatatggattccaatgccctggttgtttcccagatattcattgatgaaggcccc
atcgtaaaacgaatgcggccccgggcatatggccgtgcagatgtcaggcgccatagaacc
agccacattaccgtggtgctaagggaaagggaggtaaaatag

DBGET integrated database retrieval system