KEGG   Syntrophomonas wolfei: Swol_2421Help
Entry
Swol_2421         CDS       T00396                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
swo  Syntrophomonas wolfei
Pathway
swo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:swo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Swol_2421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:swo01007]
    Swol_2421
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:swo03016]
    Swol_2421
   03029 Mitochondrial biogenesis [BR:swo03029]
    Swol_2421
Enzymes [BR:swo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Swol_2421
Amino acid related enzymes [BR:swo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Swol_2421
Transfer RNA biogenesis [BR:swo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Swol_2421
 Prokaryotic Type
   Other AARSs
    Swol_2421
Mitochondrial biogenesis [BR:swo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Swol_2421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ABI69710
UniProt: Q0AU94
Position
complement(2750001..2751680)
Genome map
AA seq 559 aa AA seqDB search
MNPIQKVLASLHSMVIEALEKAKSRDLIKFDQIPEFLIEVPREKEHGDFACNVALLMARQ
ARQAPRAIAEVLVELMEASGRPVEKIEIAGAGFINFFLDRSWLYEIPLMVYKSKDKYGFN
GEKAKKVQVEFVSANPTGNLHMGNARGGAIGDTLANILERAGYEVEREFYINDAGNQIEI
FTDSMEARYLQLTGHDVQFPENGYAGRDLIDTVRNIIARYGEGLYDLPREERRQIIVDFA
LEEKIDYIQKTLASFGINYDVWFSEKSLHENGKIMAVFNDLRDKGYIYESEGAWWFKSTA
FGDEKDEVVLRANGMPTYFMADIAYHQNKFERGFDWVINVWGADHHGHVARMKGAIEALG
YDPARLDILLMQLVRLYRGGNIVRMSKRTGTTVSLDELIEDVGKDAARFFFVMRSPDSHL
DFDLELARQKSQENPVYYVQYAHARICSIFRQARAEGITMAEINEIDISCLKEEEELAIL
RKIADFPEEISIAARTLAPHRIARYVLDLAALFHSFYNHHRVLNDNRALQDARLLLMEIT
RITIHNALDVLGVAAPEQM
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccatacaaaaagtcctggcttctttgcacagcatggtgatagaagcattggaa
aaggctaaatccagggatttaataaaatttgaccaaattccggaatttcttatcgaagtt
ccccgggaaaaggaacatggtgattttgcctgtaatgtcgctcttttaatggcgcgtcag
gccaggcaggctcctcgcgccattgccgaagtgctggtggaattgatggaagcgagcggg
cgtccggtggagaagattgaaatcgccggagccggctttatcaacttttttctggatcgg
agctggctttatgaaatccctttaatggtatataagagcaaggataaatatggattcaat
ggagaaaaagccaaaaaggtgcaagtggaatttgtcagcgctaatcctactggtaatcta
catatgggaaatgcacggggtggtgctatcggagataccctggccaatatcctggaacgg
gccggttatgaggtggagcgggaattctatattaatgatgccggcaatcagatagaaata
ttcactgattccatggaggcccgctacctgcagttaacgggacatgatgtgcagttcccg
gaaaacggctacgccgggcgggatcttatcgatacggtcaggaatattattgctcgttac
ggcgagggcttatatgatttaccccgggaggaaaggcggcagataatagttgattttgct
ctggaggagaagatagattatatccagaaaaccctggccagctttggcatcaattatgat
gtatggttcagtgaaaaaagcctgcatgaaaacggtaagataatggcggtttttaatgat
ttgcgggataagggttatatttatgaaagcgaaggagcttggtggtttaaatccactgct
tttggcgatgagaaggatgaagtggttttacgggccaatggaatgcctacttattttatg
gccgatattgcttatcatcagaacaagtttgaacggggttttgactgggttataaatgtt
tggggggctgaccaccatgggcatgttgcccgcatgaaaggggctatagaagctctgggc
tacgacccggccaggctggacatactcttgatgcaactggtcagattataccggggcggt
aatatagtacggatgtccaaacggaccggaaccaccgtttccctggatgagttgattgag
gatgtgggcaaggatgccgcccgcttcttttttgttatgcgcagcccggacagccatttg
gattttgacctggaattggcccggcagaagagccaggaaaacccggtatattatgtacaa
tatgctcatgcccgaatctgcagtatattcagacaagcccgggccgagggtattaccatg
gcggagataaatgaaattgatatttcctgcttaaaggaagaggaagaactagctatatta
aggaaaatagcggatttccccgaagaaatctctatagccgccagaacccttgctccccat
cggatagcccgttatgtattggatttagccgcgttattccacagtttctacaatcaccac
cgggttttgaatgataaccgggctttgcaggatgcccggcttttgttaatggagataacc
cgcattaccatacataatgcgctggatgtactgggggttgctgctcccgaacaaatgtag

DBGET integrated database retrieval system