KEGG   Shewanella piezotolerans: swp_0283
Entry
swp_0283          CDS       T00791                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
swp  Shewanella piezotolerans
Brite
KEGG Orthology (KO) [BR:swp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:swp03016]
    swp_0283
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     swp_0283
Transfer RNA biogenesis [BR:swp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    swp_0283
 Prokaryotic type
    swp_0283
SSDB
Motif
Pfam: Tyr_Deacylase BIg21
Other DBs
NCBI-ProteinID: ACJ27123
UniProt: B8CHJ7
Position
293862..294299
AA seq 145 aa
MIALIQRVSEANVVVDGETIGEIDKGLLVLLGVEREDDLAKMEKLATKVMSYRVFSDDNG
KMNLNLEQAGGSLLVVSQFTLAADTGRGLRPSFSGAGTPEQARELYQAFVDFCLSKGVNT
QTGEFAADMKVSLVNDGPVTFNLQV
NT seq 438 nt   +upstreamnt  +downstreamnt
gtgattgccttaattcaacgtgtaagtgaagctaacgtagtcgttgatggtgaaaccatt
ggagagatagataaaggcctgttagtgctattaggtgttgagcgcgaagatgatttagcc
aaaatggagaagctggcgactaaggtgatgagttatcgagttttctccgatgacaatggc
aagatgaaccttaacttagagcaagctggcggcagtttattagtggtgtcgcagtttacc
ttagcggcagatactggtcgcggtctacgccctagcttttcgggggcaggaacacccgaa
caagcgcgagaactttaccaagcttttgttgatttttgtctatctaaaggcgttaacaca
caaacgggtgagtttgctgcagatatgaaagtctctttggtcaatgacggccctgttacc
tttaacctacaggtatag

DBGET integrated database retrieval system