KEGG   Shewanella piezotolerans: swp_0321Help
Entry
swp_0321          CDS       T00791                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
swp  Shewanella piezotolerans
Pathway
swp00230  Purine metabolism
swp01100  Metabolic pathways
Module
swp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    swp_0321
Enzymes [BR:swp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     swp_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 ABC_tran Peptidase_M28 MMR_HSR1 RsgA_GTPase AAA_33 Lactonase AAA_29 AAA_22 cobW
Motif
Other DBs
NCBI-ProteinID: ACJ27156
UniProt: B8CHN0
Position
complement(325000..325623)
Genome map
AA seq 207 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDQPADMQVSVSHTTRQPRPGEEHGQHYHFVNQD
EFKSLIAENAFFEWAEVFGNYYGTSRVTIEHTLAKGIDVFLDIDWQGAQQVKKVMPESIG
IFILPPSRAELERRLTGRGQDSQEVIAGRMAQAVSEMSHYNEYDFILVNDDFDKAQSDLL
AIIHSQRLTTASQIHTQNDMIKDLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgcggaaatctatttatcgtttcagcgccaagtggcgcaggtaaatcatca
ctgatatcagctcttttgaaagaccaacccgctgatatgcaagtgtctgtgtcgcatacc
acccgccaacctcgtccaggtgaagagcatggtcagcactatcactttgttaatcaagat
gagtttaaaagcctaattgctgaaaatgctttttttgaatgggcagaggtttttggtaat
tactacggcacttcacgagttaccattgagcatacattggcaaaaggtatcgacgtattt
ctcgatattgattggcaaggcgctcagcaagtgaaaaaagtgatgcctgaatccatcggt
attttcattcttcccccttcacgtgctgagctagagcgccgtcttactgggcgtggccaa
gatagccaagaagtgattgcaggccggatggcacaagctgtttcagagatgtcgcactat
aatgagtatgattttattttagtgaacgatgatttcgacaaagcgcagagcgatctttta
gctatcattcatagccaaagattaaccactgctagccaaattcatacgcaaaatgatatg
attaaagatctgttggcagactaa

DBGET integrated database retrieval system