KEGG   Shewanella piezotolerans: swp_0719Help
Entry
swp_0719          CDS       T00791                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
swp  Shewanella piezotolerans
Pathway
swp00473  D-Alanine metabolism
swp01100  Metabolic pathways
swp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    swp_0719
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    swp_0719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:swp01011]
    swp_0719
Enzymes [BR:swp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     swp_0719
Peptidoglycan biosynthesis and degradation proteins [BR:swp01011]
 Precursor biosynthesis
  Racemase
   swp_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACJ27535
UniProt: B8CIQ9
Position
722166..723242
Genome map
AA seq 358 aa AA seqDB search
MKPFPRAEISRKALKHNLARLHELAPSSKVMAVVKANGYGHGLLNVAQCLDNADGFGLAR
LEEALALRTGGVTAKLLLLEGFFRIGDLTTLVEHDIETVVHHESQLEMLESINLTKPVTV
WLKVDSGMHRLGFSPAQFDATYQRLMANDNVAKPIHLMTHFACADEPSNPSTAEQQRVFD
TLIKGLPGDRTLANSAGALFWQQSQADWIRPGIALYGVSPVFGDLGAKHGLMPAMDLVSQ
LIAIREHKAGESAGYGSYWTAEKDTNLGVVAIGYGDGYPRNAPLGTPVLVNGRIVPIVGR
VSMDMLTVDLGIDANDKVGDLAVLWGKELPVEEVAEHIGTIAYELVTKLTPRVAVCLD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaccattcccacgcgcagagatcagccgcaaagcactaaagcataatttagcccga
ctgcatgagttagctccgtcaagcaaggtgatggcggtagtaaaagctaatggctatggc
catggtttactcaatgttgctcaatgcttagataatgctgatggctttggtttagcgcgc
cttgaagaagcacttgcgcttcgaacgggtggagttaccgctaaattattgttgcttgaa
ggttttttccgtattggagatctaaccactttagttgagcatgacattgaaaccgtggtg
catcatgaatctcagctggaaatgttggaaagtatcaatttaactaagccggtcactgtt
tggcttaaagtcgatagtggcatgcatcgtcttggcttttcgcctgcgcagttcgacgct
acttaccaaaggttaatggccaatgacaatgttgccaagccgatccacttgatgactcac
tttgcttgcgccgatgaaccgagcaatcctagtaccgctgagcagcagagagtatttgat
accttgatcaaaggtcttcctggtgatcgcacactggctaattctgcaggcgctctgttt
tggcagcaaagccaagcagactggattagacctggaatagcactttatggtgtctcacca
gtttttggcgatctcggcgctaaacatggcttaatgcctgcgatggatttagtctctcag
ctgattgctatacgtgagcacaaagcgggtgaaagtgcgggctatggtagctattggact
gcagaaaaagacactaatcttggcgtcgttgctatcgggtacggtgatggctatccacgc
aatgcaccacttggtactcctgtactggttaatggtcgtattgtgccgattgtaggtaga
gtgtcgatggatatgctgaccgtggatctcggtattgatgctaatgataaagtgggcgat
ctcgcagttttgtggggtaaagaactgcctgttgaagaggtagctgaacatattggtact
atcgcttatgagcttgttaccaagctcactcctcgcgttgctgtttgcctagattga

DBGET integrated database retrieval system