KEGG   Shewanella piezotolerans: swp_1230Help
Entry
swp_1230          CDS       T00791                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
swp  Shewanella piezotolerans
Pathway
swp00240  Pyrimidine metabolism
swp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    swp_1230
Enzymes [BR:swp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     swp_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ACJ28024
UniProt: B8CKI5
Position
1241313..1242644
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNAEVLSTEEIQFFVNGITNNTVSEGQIAALGMAVYFNDMNMDERIALT
TSMRDSGTVLDWKSLDLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYNTEPDSALFRKVVKEAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGTGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAVDFMTGAYRNPRLYEVTMGLCAEMLTLGGIASNEAEARAKL
NEVLDNGKAAEIFGRMVSGLGGPTDFVENYSKYLPDSQIIRPVYAEQTGFATAMDTRELG
LAVVTLGGGRRKPGDTLDYSVGLTKVCALGDEVSADKPIAFIHAQSEGAFAEAEAAVKKA
IHIGDTKPEKTPEIYRYIRESDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagctcaagaaattattcgtaaaaaacgtaatgctgaagtcctttcaactgaa
gaaatccaattcttcgttaacggcatcactaataacaccgtttctgaagggcagatcgct
gcgcttggtatggctgtttacttcaacgacatgaatatggatgagcgtattgcgctgacc
acatctatgcgtgactctggtacggttctcgactggaaatctcttgaccttaatggtccg
attatcgataagcactcaactggcggtgtgggggatgtcattagtttgatgttaggccca
atggctgctgcttgcggtggttatgtacctatgatttctggccgcggcctaggtcatact
ggcggtacgcttgataagtttgatgctatccctggttacaataccgagcctgatagcgct
ttgttccgcaaagttgttaaagaggctggtgtggcgattattggtcagactggtgatctt
gtccctgctgataagcgcttttactctattcgtgataataccgcgaccgttgagtctatc
tctctgattaccgcttcaattctttctaaaaagttagctgctggactcgatgcccttgca
atggacgttaaagtcggtacaggtgcttttatgccgacttatgaagcatcagaagagctt
gcccgcagtatcactgcagtcgctaatggagcaggcactaaaaccactgcactattgact
gacatgaaccaagttttggcctcatgtgcaggtaatgcggtagaggttaaagaagctgtt
gacttcatgaccggtgcttaccgtaaccctcgcctttacgaagtgacgatggggctttgt
gctgagatgcttacccttggtggtattgcaagcaatgaagcagaggcacgcgccaagctg
aatgaagtactcgataatggcaaagcggctgaaatatttggtcgtatggtatcaggtcta
ggtggaccgactgattttgttgagaactacagtaaatacctacctgattcacaaatcatt
cgtcctgtatatgctgagcaaactggtttcgcgacagctatggatacccgtgaactcggt
ctcgctgttgttactctcggtggtgggcgccgcaagcctggcgacacactcgattatagt
gttggactgactaaagtttgcgcccttggcgatgaagtcagtgccgacaagcctatcgca
tttattcacgcccaatctgaaggtgcctttgctgaagcggaagctgcagtgaagaaagcg
attcatattggcgataccaagccagaaaagactcctgagatatatcgttatatccgtgag
tcagatctgtaa

DBGET integrated database retrieval system