KEGG   Shewanella piezotolerans: swp_1379Help
Entry
swp_1379          CDS       T00791                                 

Definition
(GenBank) Oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
swp  Shewanella piezotolerans
Pathway
swp00620  Pyruvate metabolism
swp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    swp_1379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:swp02000]
    swp_1379
Enzymes [BR:swp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     swp_1379
Transporters [BR:swp02000]
 Other transporters
  Primary active transporters [TC:3]
   swp_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: ACJ28166
UniProt: B8CJR9
Position
1402810..1404618
Genome map
AA seq 602 aa AA seqDB search
MSKPLALTDVVLRDAHQSILATRLRTEDMLPIAPLLDKVGFWSLESWGGATFDSCIRYLG
EDPWERIRELKKVMPNTPQQMLLRGQNLLGYRHYADDLVNRFVERAHTNGVDVFRIFDAM
NDVRNLETAVKSVVEVGAHAQGTLSYTTSPVHTTATWVDMAKRIEDMGCHSLCIKDMAGL
LKPFEAYEMISQIKSQTDLTVSLHCHATTGLSTATYQKAIEAGIDVLDTAISSMSQTYGH
SATETVVAMVEGSDRATGYDMALLEEIAAYFRIVRKKYAAFEGELKGIDSRILRAQVPGG
MLTNMESQLKEQGAADKLDLVLEEIPRVREDLGFLPLVTPTSQIVGTQSVINVLTGERYK
SMTKETEGVLKGEYGATPAPVNSELQQRVLDGTEAITCRPADLLEAELDRLRVELAEKAT
AEAITLATELDDDVLTYALFPQIGLKFLKNRHNPDAFEPKPEVAAKALEEAKKAELAIAA
KSGPETYTVTVQGQRFVVEVAEGGDISEITPAENVVPFSAPAPAAAVDTSVVKLEQNAPL
SGNIFKVHVSPGDSVKEGDVVIILEAMKMETEVRAEADGVISQVWVKEGDSVAVGSQLLA
IA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccactggctttaaccgatgtcgtcttaagagatgctcaccaatcaatactc
gctactcggttgcgtaccgaagatatgttacctattgcaccactacttgataaggttggc
ttttggtcacttgaatcatggggcggagcaacgtttgattcttgtatccgttaccttggt
gaagatccttgggaacgcattcgcgaactaaagaaagtgatgcctaacacgcctcagcag
atgctacttcgagggcaaaacctcttaggctatcgtcactatgcagatgatttagtcaac
cgatttgtagaacgtgctcatactaatggtgtcgatgtgttccgtatctttgatgcaatg
aatgatgtgcgtaacctcgaaacagcagttaaatctgtagtagaagttggtgctcatgca
caaggaactttgtcttacacaaccagccctgtacacacaacagcgacttgggttgatatg
gccaaacgcattgaggatatgggctgtcactcattgtgtattaaagatatggctgggcta
ttaaagccatttgaggcttatgagatgataagccagatcaagtcgcaaactgatttaacc
gtttccttgcattgccacgcgacaacaggccttagcaccgcgacttatcaaaaagcaatc
gaagccgggattgatgttcttgatactgctatttcatccatgagccaaacctacggacac
agtgccactgaaaccgtagtcgctatggttgaaggctctgacagagcaactggttatgat
atggcgctactggaagagattgcagcttacttcagaatcgttcgaaaaaaatatgccgca
tttgagggtgaacttaaaggaattgattcacgcatacttcgcgcgcaagtgcctggtggc
atgctaactaatatggaaagtcagctcaaagagcaaggcgcggcagataagttagatttg
gtgttagaagagatccctcgtgttcgtgaagatttagggtttctgccgttggtaacacct
acttcgcaaatagtgggtacccagtcagtcatcaatgttttaacgggtgagcgttataag
tcgatgactaaagagacggaaggcgtcctaaaaggtgagtacggtgcgacaccggcaccg
gtaaatagtgaattgcagcagcgggttcttgatggcacagaagctatcacttgtcgccct
gctgatctgctcgaagctgaactcgataggttgcgagttgagcttgctgaaaaggcaacg
gcagaggccattactctggcaactgagctcgatgatgacgtattaacttacgcgctattc
ccccagattggacttaagtttcttaaaaatagacacaaccctgatgcgtttgagcccaaa
cctgaagtagccgctaaggcattagaggaggctaaaaaggcagagcttgccatcgcagcc
aaatctggtccagaaacttacacagtgacggttcaagggcaacgttttgtggttgaggtc
gctgaaggtggcgatatcagtgaaattactccagctgaaaatgtggtgccattttcagcg
cctgcaccagccgctgctgttgatacgtcagtggtaaagcttgaacaaaatgccccgctt
tcaggtaatatttttaaggtgcatgtgtctccaggtgatagcgtaaaagagggtgatgtc
gtgatcattcttgaagcgatgaagatggaaacggaagtaagggctgaggccgatggagtg
atctctcaggtttgggtgaaagagggtgattcggttgcagtgggtagtcaactgcttgcc
atagcttag

DBGET integrated database retrieval system