KEGG   Shewanella piezotolerans: swp_1676
Entry
swp_1676          CDS       T00791                                 

Definition
(GenBank) Queuosine biosynthesis protein
  KO
K07568  S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC:2.4.99.17]
Organism
swp  Shewanella piezotolerans
Brite
KEGG Orthology (KO) [BR:swp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:swp03016]
    swp_1676
Enzymes [BR:swp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.17  S-adenosylmethionine:tRNA ribosyltransferase-isomerase
     swp_1676
Transfer RNA biogenesis [BR:swp03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    swp_1676
SSDB
Motif
Pfam: Queuosine_synth ROS_MUCR
Other DBs
NCBI-ProteinID: ACJ28450
UniProt: B8CLC4
Position
1735293..1736330
AA seq 345 aa
MRVADFSFELPDELIARYPTAERTASRLLSLDGNSGALADLQFTAILEKVQPGDLMVFNN
TRVIPARLFGKKQSGGKLEILVERMLDDKRILAHVRCSKSPKVDNIICLDNGYEMKMCAR
HDALFELELQSDKTILEVLEEVGHMPLPPYIDRPDEDADKERYQTVYNQTPGAVAAPTAG
LHFDDAMLAALKDKGVKTAFVTLHVGAGTFQPVRVDEILDHKMHSEWAEVSQDVVDLIAL
TKANGHRVIAVGTTSVRSLESAARASAAELEAFSGDTDIFIYPGYQFQVVDAMVTNFHLP
ESTLIMLLSAFAGFDEVKTAYQHAIAQKYRFFSYGDAMFVTKKAN
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcgtgttgcagatttttcttttgaacttcccgatgagcttattgcgcgttatccgacg
gcagagcgcacagcttcaagacttctatcgttagatggtaacagcggcgcattagccgat
ttgcaatttaccgcaatactagaaaaagtacagcccggtgatttaatggtatttaacaat
acccgagttatccctgcgcgcttatttggtaaaaagcaatctggcggtaagttagagata
ctggttgagcggatgctcgatgacaagcgtattcttgctcacgtccgttgctctaagtca
ccaaaagtagataatattatttgtctcgacaacgggtacgaaatgaagatgtgtgctcgt
cacgatgctttattcgaacttgagctacaatcagataaaacaattcttgaggtattggaa
gaagtagggcacatgccgctaccgccttatatagatagacctgatgaggatgcagataaa
gagcgttatcagacagtctacaaccaaactccaggtgcagtggcagccccaacagcgggc
ttacattttgatgacgcaatgctcgctgcacttaaagacaaaggcgtaaaaacggcattt
gttaccttgcacgtcggtgcaggtacttttcagcctgtacgagtcgatgagatccttgat
cataaaatgcattctgaatgggctgaagtttcgcaagatgtcgttgacctcatagcattg
acgaaagcaaacggtcatcgagtgattgctgttggtacaacatcagtgcgttcactagaa
agtgccgctagggcatcagctgctgagttagaggcatttagtggcgatactgatatcttt
atctatcctggttatcagttccaagtagtcgatgcaatggtgacaaattttcacctgcct
gagtcgacgttaataatgttgcttagtgcatttgctggcttcgatgaggtaaaaaccgcc
tatcagcatgcgattgctcaaaaataccgcttctttagctatggcgacgccatgtttgtg
actaaaaaagcgaactaa

DBGET integrated database retrieval system