KEGG   Shewanella piezotolerans: swp_1868Help
Entry
swp_1868          CDS       T00791                                 

Definition
(GenBank) Isocitrate dehydrogenase NADP-dependent, monomeric type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
swp  Shewanella piezotolerans
Pathway
swp00020  Citrate cycle (TCA cycle)
swp00480  Glutathione metabolism
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01200  Carbon metabolism
swp01210  2-Oxocarboxylic acid metabolism
swp01230  Biosynthesis of amino acids
Module
swp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
swp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    swp_1868
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    swp_1868
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     swp_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ACJ28630
UniProt: B8CLH9
Position
1920889..1923114
Genome map
AA seq 741 aa AA seqDB search
MNDKSSTIIYTETDEAPALATLSLLPIIQKFTQSAGVDVETRDISLSGRIISIFPENLTA
EQKISDALAELGELAKTPEANIIKLPNISASIPQLKACILELQNKGYDIPNYPDEPANDV
EKDIQARYDKIKGSAVNPVLREGNSDRRAPGSVKKFAQKNPHSMGKWSTDSKSHVAHMNE
GDFYGSEKSVTLADAGSVSIVLSKTDGSEQVLRNAIALQAGEVIDSAVMSKAALVSFYER
ETLNAKEQDVLLSLHLKATMMKVSDPILFGHAVKVYYKDVFAKHGQLFEELGVDVNNGVG
DVYAKIASLPAEQKAAIEADIAAVYASSAELAMVDSDKGITNLHVPSDVIIDASMPAAIR
TSGQMWGPDGQLKDMKAMIPDRCYAGVYQETIDFCINNGAFNPSTMGSVPNVGLMAQKAE
EYGSHDKTFEISDAGTVNVVDQNGVVLMSHNVEAGDIFRMCQVKDAPIRDWVKLAVNRSR
LSATPAVFWLDAARAHDAEIIKKVELYLKDHDTNGLELHIMSPVEATRFTLARVKAGQDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQVEKEGH
LRWDSLGEFLALGASLEHLSQTTNNARAQVLADTLDLAIGQFLDTNKSPSRRVGELDNRG
SHFYLAMYWAQAVAAQTQDSELQAQFTAFAEALTSNEETIVAELNGVQGPAVDLGGYYRL
DAAKASDAMRPSATLNALING
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaatcatcaacgatcatctataccgaaactgacgaagctccagcactggca
actctttctttgttacccattatccagaagtttacccaaagtgcaggtgttgacgttgag
actcgtgacatttcattgtcaggtcgaatcatctcaattttccctgaaaatttaacagca
gaacaaaaaatcagtgatgcattagcggaactaggcgaactggcgaagacgccagaagct
aacattattaagctgccaaacatcagtgcgtcaatcccacaattaaaagcatgtatttta
gaactgcaaaataaagggtatgacattcctaactaccctgatgagcctgcaaacgatgtt
gaaaaagacattcaagcacgttacgacaaaattaaaggcagcgcggtaaaccctgtatta
cgtgaaggtaactctgatcgtcgcgcacctggttcagtgaaaaagtttgctcagaaaaac
ccacattcaatgggcaaatggtcaactgactctaaatctcatgttgctcacatgaatgaa
ggcgatttttacggtagtgaaaagtctgtcacgctcgctgatgcaggtagtgtttcaatt
gtattgagcaagaccgatggttcagagcaagtgctacgaaatgcaattgctttgcaagct
ggagaggttattgattctgcagtgatgagcaaagccgctttggttagcttttatgagcgc
gaaacattaaacgctaaagagcaggatgtgctgttgtcgctacacttgaaagccacaatg
atgaaagtctctgatccaattttattcggccatgccgttaaagtttactacaaagacgtt
tttgctaagcacggtcaactatttgaagagttgggtgttgatgtcaataacggtgtgggt
gatgtttacgctaaaatcgcatcattaccggctgagcagaaagcggctattgaagctgat
atcgcagcggtttatgcaagcagcgctgagctggcgatggttgattcagacaaagggatc
accaacttgcacgtaccaagtgatgtgattattgatgcctcaatgcccgctgcaatccgt
acatcggggcagatgtgggggcctgatggccaactaaaagacatgaaagcaatgatccct
gatcgttgttatgcgggtgtgtaccaagaaacaattgatttctgtatcaacaatggtgca
tttaatccaagcactatgggtagtgtacctaacgtagggctcatggcccaaaaagcggaa
gagtacggtagccacgacaagacttttgaaatttctgatgcaggcaccgttaacgtcgtt
gatcaaaatggcgttgtgcttatgtcgcacaatgttgaagctggcgacatctttagaatg
tgtcaggttaaagacgcgccaattcgtgactgggttaaacttgccgttaaccgttcacgt
ttatcagcgactccagctgtattttggttagatgccgcccgtgctcacgatgctgaaatc
atcaaaaaggttgagctctacctgaaagatcacgataccaatggtcttgagcttcatatc
atgtcgccagttgaggctacacgctttaccctagcgcgcgttaaagcaggccaagatacg
atttctgtcacgggtaacgttttacgtgactacctaaccgacctattcccaattcttgag
cttggcacaagtgctaaaatgctatcaattgtgccactaatgaatggtggtggattgttt
gaaacaggtgcaggtggtagtgcgcctaagcacgtgcagcaggttgagaaagaggggcat
ttacgttgggattcattgggtgagttcctcgcgctcggtgcctctttagagcaccttagc
caaacaaccaacaatgccagagcacaggtattagctgacacgctagatttggcaatcggt
cagttcctcgatacaaataagtctccttcacgccgtgtgggtgaacttgataatcgtgga
agccacttctaccttgctatgtattgggctcaggctgttgcagcgcaaacgcaagatagt
gagttacaagcacaattcacagcttttgcagaagcactgacgagtaacgaagaaacaatt
gttgccgagttaaatggtgttcaaggaccagcagtagacttaggcggttactatcgtcta
gacgcggcaaaggcatctgatgcaatgcgtccaagtgcaacgcttaacgcattaattaac
ggctag

DBGET integrated database retrieval system