KEGG   Shewanella piezotolerans: swp_1982Help
Entry
swp_1982          CDS       T00791                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
swp  Shewanella piezotolerans
Pathway
swp00040  Pentose and glucuronate interconversions
swp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    swp_1982
   00053 Ascorbate and aldarate metabolism
    swp_1982
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     swp_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACJ28739
UniProt: B8CNA5
Position
complement(2051745..2053310)
Genome map
AA seq 521 aa AA seqDB search
MTDLTSVTISGQHFINGKWTDETLQFNSMNPVLNESTQWQFASANTKNIEAAVSAAKQAF
LSYRRTTDEQRADFLDAIAEEIQADIAAITETAHIETGLPMPRLQGETGRTCGQLKLFAS
TLRSPINNVLIDLANPERQPLPKPDTRLGTLPVGPVAVFGASNFPLAFSTAGGDTASALA
AGCSVVVKGHPAHAATSELVTRAVARAVSRCNMPAGVFNLIQSTEPQASTQLVNHSAIKA
VGFTGSLKVGRILADICAARAEPIPFYGELGSINPQFLLGELLTEQAESLATTQVQSMMM
GHGQFCTSPGVVVAVKGEALNRYLATMAEKIALESAASMLTAGIAATFQSQVDSFLNNPS
VALISQGKASPANHFTRPAAVTIEAEDYLASQTLQQEVFGPFAVVVACNDLAQMELIAEQ
MEGQLTASIHGLEAELSENTQLIESVSFNVGRLIFNQMPTGVEVCHSMNHGGPYPASTDS
RTTSVGTQAMVRFVRPLCIQNMPVALMPEKLKEGQSNITTF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttaacaagcgttacaataagtggccaacattttatcaatggcaagtggact
gatgaaacattgcaatttaatagtatgaaccctgtgctaaatgaatccacacagtggcaa
ttcgcttccgctaatacaaaaaatatcgaagctgcagtgagcgctgcaaagcaagcattt
ttatcttatagacgcaccacagatgagcaacgcgcagatttcttagacgctatagcagaa
gagatccaagcggatatagccgccataacggaaacggctcatattgaaactggcttacct
atgccacgtctacaaggtgaaaccggccgaacatgtgggcaactaaaattatttgccagc
acgctacgctcgccaatcaacaatgtactgattgatcttgctaaccctgaaagacaacct
ttaccaaagccagatactcgcttgggcactttacccgtaggtcctgtagccgtttttggc
gcatctaacttcccgctagcattttcaactgccggtggcgatacagcttctgcactagca
gcaggttgcagtgtcgtcgtaaaggggcacccagcacacgcagcgaccagtgaacttgtg
acccgtgcagttgctcgcgcggttagtcgttgcaatatgcctgcaggcgtatttaacctt
attcagtcgacggaaccgcaagcttcaactcaacttgtcaaccatagcgcaataaaagcg
gttggctttacaggctctttgaaagtcggtcgtattttagctgacatttgcgcagctaga
gctgaacctattcctttttatggtgagctaggctctattaaccctcaatttttactcggt
gaactgttaacagagcaagctgaaagtttggccacaactcaagtgcagtcgatgatgatg
ggacacggtcaattctgtaccagccctggcgttgttgtagcggtaaaaggggaagcactg
aatcgctaccttgcaaccatggctgaaaaaattgcacttgaatccgctgcgagcatgctg
acagcaggcattgcagcgaccttccaatcacaagtcgactcatttttaaacaatccgtca
gttgcactgatatcacaagggaaggcctctcctgctaaccactttacacgaccagcagca
gtaacaattgaagctgaagattatcttgcttctcaaacactgcaacaggaagtatttggt
ccattcgcagtggttgtggcttgtaatgatttagcccagatggagttgattgctgagcag
atggaaggtcaattaaccgcttcaattcatggcctagaagcggaactctctgaaaacacc
caattgatagagtcggtgtcattcaatgttggtcgcttgattttcaatcaaatgccaaca
ggagtcgaagtttgccactcaatgaaccacggcggtccctaccctgccagcacagatagt
cgcacgacatcagtaggaacccaagcaatggtccgttttgtacgtcctttatgcatacaa
aacatgcctgtagcattaatgcctgaaaagttaaaagaagggcaatcaaatatcaccacc
ttctaa

DBGET integrated database retrieval system