KEGG   Shewanella piezotolerans: swp_2200
Entry
swp_2200          CDS       T00791                                 

Definition
(GenBank) Transcriptional regulator, TetR family
  KO
K05501  TetR/AcrR family transcriptional regulator
Organism
swp  Shewanella piezotolerans
Brite
KEGG Orthology (KO) [BR:swp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:swp03000]
    swp_2200
   03036 Chromosome and associated proteins [BR:swp03036]
    swp_2200
Transcription factors [BR:swp03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    swp_2200
Chromosome and associated proteins [BR:swp03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    swp_2200
SSDB
Motif
Pfam: TetR_N HTH_11 STAT_int HTH_AsnC-type
Other DBs
NCBI-ProteinID: ACJ28950
UniProt: B8CM26
Position
complement(2291414..2292007)
AA seq 197 aa
MAASPKINRREHILQCLATMLETSPGQRITTAKLAAEVGVSEAALYRHFPSKARMFEGLI
EFIEESLLSRINLIMDEEKDTMKRCQQLLQLLLVFAERNPGISRVLNGDALLGENERLRS
RISQLFSKIETHLKQILREKSLREGQAFSIDEAVLANLLMAIAEGRIAQFVRSEFKLKPT
KHFNEQWTFVQQQLLQS
NT seq 594 nt   +upstreamnt  +downstreamnt
atggctgcaagcccaaagattaatcgccgcgaacacattctacaatgtttagcgaccatg
ttagagacaagcccaggacaacgcatcactaccgctaaactggctgcagaagtgggtgta
tcagaagcggcactctatcgtcattttccgagcaaagcgcggatgtttgaaggcctgata
gagtttatcgaagagtcattactatctcgcatcaatctcatcatggatgaagaaaaggac
accatgaaacgctgtcaacaattactgcaattgttgttggtttttgccgaacgtaatcca
gggatttcaagggtgctcaatggtgatgcgttactgggtgaaaacgagcgtttacgcagc
cgcattagccagcttttctcaaaaattgaaactcatctgaagcaaattttacgcgagaag
agcctgcgcgaagggcaagcatttagcattgatgaagcagtattagccaaccttttaatg
gcgattgccgagggacgaattgcccaattcgtgcgcagcgagtttaaactaaaaccgact
aagcattttaacgaacagtggacatttgtgcagcagcaacttctgcaaagctag

DBGET integrated database retrieval system