KEGG   Shewanella piezotolerans: swp_3139Help
Entry
swp_3139          CDS       T00791                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase:3-hydroxyacyl-CoA dehydrogenase:3-hydroxyacyl-CoA dehydrogenase, NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
swp  Shewanella piezotolerans
Pathway
swp00071  Fatty acid degradation
swp00280  Valine, leucine and isoleucine degradation
swp00281  Geraniol degradation
swp00310  Lysine degradation
swp00362  Benzoate degradation
swp00380  Tryptophan metabolism
swp00410  beta-Alanine metabolism
swp00640  Propanoate metabolism
swp00650  Butanoate metabolism
swp00903  Limonene and pinene degradation
swp00930  Caprolactam degradation
swp01040  Biosynthesis of unsaturated fatty acids
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
swp01212  Fatty acid metabolism
Module
swp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    swp_3139
   00650 Butanoate metabolism
    swp_3139
  Lipid metabolism
   00071 Fatty acid degradation
    swp_3139
   01040 Biosynthesis of unsaturated fatty acids
    swp_3139
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    swp_3139
   00310 Lysine degradation
    swp_3139
   00380 Tryptophan metabolism
    swp_3139
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    swp_3139
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    swp_3139
   00281 Geraniol degradation
    swp_3139
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    swp_3139
   00930 Caprolactam degradation
    swp_3139
Enzymes [BR:swp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     swp_3139
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     swp_3139
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     swp_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACJ29849
UniProt: B8CPY6
Position
complement(3291899..3294019)
Genome map
AA seq 706 aa AA seqDB search
MEKTFNLARREDGIAILTMDVPGETMNTLRSEFGPEISEMLAEIKQDSSIKGLVLVSGKK
DSFVAGADISMLDACETAMDAKLLSQQGHVVFNELENLSIPVVAAINGACLGGGLELALA
CHQRVCSLNSKTMMGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQAIKM
GLVDDAVPESILMRTAIEMALAGKRTAKKKKQSFINKMLEGTSAGRNIIFDQAGKQVAKK
TQGNYPAPAKIIDCVRQGMTKGLIKGLEVEASHFSDLVISKESEALRSIFFATTEMKKET
GAGDVEPRKVKKAMILGGGLMGGGIASVTTTKAKIPARVKDISETGLSNALSYAYKLLDK
GVKRRHMTPAVRDNLMALMTTTTEYKGIKDADIVVEAVFEDLSLKHQMVKDVERECGENT
IFASNTSSLPISQIAEAATRPENVIGLHYFSPVEKMPLVEVIAHEKTSAETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPMTLLDE
VGIDVGAKISPTLEAELGERFKAPSAFDKLLADDRKGRKNGKGFYQYGSKKKAKEVDSSV
YAVLGLTPGQNSDANELALRCVVQMLNEAVRCLEEGIIASARDGDIGAIFGIGFPPFLGG
PFHYIDTLGPAKLVEILSGYQSQFGDRFAPAELLKQMANEQSYFFK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttagctcgccgagaagatggtattgccatattaaccatggat
gtacctggtgagacgatgaatacgctgcgcagtgaatttggtccagagatcagtgagatg
cttgctgaaataaagcaagacagcagtataaaaggtttggtgctagtttcaggcaagaag
gactcctttgttgcgggtgcagatatatcaatgttagatgcatgcgaaaccgcaatggat
gcgaagttactttctcaacaagggcatgtggtttttaatgagttagaaaacttatctatc
ccagtcgttgctgcgattaatggtgcgtgtttaggcggtggtttagagttggcattagct
tgtcatcagcgagtttgtagcttaaatagcaaaacaatgatgggtgtacctgaagtgcaa
ctgggtttacttcctggtggtggcggtactcagcgtttaccgcgtttggttggtattaca
acagcactagatatgatgctaacaggtaagcagattaggcctaagcaagcgataaaaatg
ggcttagtcgatgatgcggtacctgagtcgatattaatgcgcaccgcgattgaaatggcg
ctggcgggtaaacgcacagccaaaaagaaaaaacagtcatttattaacaaaatgcttgaa
ggcactagtgcaggtcgaaatattatttttgaccaagctggcaaacaagtcgctaagaaa
acccagggaaattatcctgctccagccaagataatcgattgtgtacgccaaggcatgact
aagggcctaatcaaaggcttagaagtggaagcaagtcatttctctgatctagtgatatcg
aaagagtctgaagccttgagaagtattttctttgccacgacagaaatgaaaaaagagact
ggcgctggagatgttgagcctcgtaaagtcaaaaaagcgatgatccttggtggtggattg
atgggaggcggtattgcctctgttacgacgactaaagctaaaattccggctcgggttaaa
gatattagtgagacgggtttaagcaacgcgctatcttacgcatacaagttgctcgataaa
ggcgttaagcgccgccatatgacgcctgctgtgcgtgacaatttaatggctttgatgacg
acaacgacagaatataaagggattaaagatgccgatatcgtcgttgaggcagtctttgaa
gatttgtcgcttaagcatcaaatggttaaagatgtagaacgagaatgtggtgagaatact
attttcgcttcaaatacgtcatcgctgccaatatcacaaattgctgaggcagcaactcgc
cctgagaatgtcatcggtttgcactatttttcaccggttgagaaaatgcctttagtcgaa
gtcattgcccatgaaaaaacctctgccgagacgatagcaacaacagtagcttttgcacgc
aagcaaggtaaaacgcctattgtggttcaagatggcgcaggtttttacgtaaaccgtatt
cttgctctgtatatgaatgaagctgcacagctgttgttagaggggcagagtgttgagcat
ttagataaagctttggttaaatttggtttcccagtcggaccaatgacactgcttgatgaa
gttggtattgatgttggtgccaagatttctcctactttagaagctgaactcggggagcgg
tttaaggctccgtcggcatttgataagttgttagccgatgaccgtaaaggacgtaaaaac
ggcaagggtttctatcaatatggaagtaagaagaaagcaaaggaagtcgacagcagtgtg
tacgcagtacttgggttaactccgggccaaaatagtgatgcgaatgagcttgctctacgc
tgtgtggttcaaatgcttaatgaagcagtgagatgtttggaagagggtattattgcctca
gctcgagatggagatattggggcgatatttggaattggcttcccacctttcttgggtggt
ccattccattacattgatacgctcggccctgccaagttggtggagatcttaagtggatat
caatctcagtttggtgatcgttttgcacctgcagaattgctaaagcagatggcgaatgag
caaagttacttcttcaagtaa

DBGET integrated database retrieval system