KEGG   Shewanella piezotolerans: swp_3264
Entry
swp_3264          CDS       T00791                                 

Definition
(GenBank) Cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
swp  Shewanella piezotolerans
Pathway
swp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:swp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    swp_3264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:swp01007]
    swp_3264
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:swp03016]
    swp_3264
Enzymes [BR:swp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     swp_3264
Amino acid related enzymes [BR:swp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   swp_3264
Transfer RNA biogenesis [BR:swp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    swp_3264
 Prokaryotic type
    swp_3264
SSDB
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f DHC_N1
Other DBs
NCBI-ProteinID: ACJ29968
UniProt: B8CRG0
Position
complement(3425226..3426605)
AA seq 459 aa
MLKLYNTLTRQKEQFVPIQPGKIGMYVCGVTIYDLCHIGHGRTFVSFDMIVRYLRYSGYE
VNFQRNITDVDDKIIKRANENNESCDSLTERLIGEMHRDFDSLNMARPDFEPRATLHMPE
IIEMVEKLIAREHAYVAANGDVLFSVSSFPEYGRLSGQNLEQLQAGARVEVEDAKRDPMD
FVLWKMSKPGEPTWDSPWGPGRPGWHIECSAMNSKHLGNHFDIHGGGSDLQFPHHENEIA
QSCCAHDTKYVNYWMHTGMVMVDKEKMSKSLNNFFTIRDVLNHYDAATVRYFLLSGHYRS
QLNYSEENLKQAKSGLERIYTALKDLDLTVDAAPAEAFIAQFKRAMDDDFNTPEAYSVLF
EMVREINRLKLTDMQQASALGVALKQLADVLGILGQDVDTFFKGEGSDDEVAEIEALIVE
RNRARTEKDWPAADVARDGLNALGVILEDGPEGTTWRKK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgttgaagctttacaatacgcttacccgccaaaaagaacagtttgtaccaatacagccc
ggaaaaataggcatgtatgtgtgtggggtgaccatttatgatttatgtcatatcggtcat
ggacgtacttttgtttcatttgacatgattgtaaggtacttgaggtatagcggttatgag
gttaattttcagcgcaatatcaccgatgtagatgacaaaattatcaaacgcgctaatgag
aacaatgaaagttgtgactcactaacagagcgtctaattggtgagatgcacagagatttt
gattctcttaatatggcacgccctgattttgaaccgcgcgcaacgctgcatatgccagaa
atcatcgaaatggttgaaaagcttattgctcgtgaacatgcttatgtagccgccaacggt
gatgttttgttcagcgtatcatctttccctgaatatggtcgcttatctgggcaaaacctc
gaacaattgcaggctggcgctcgggtcgaagttgaagatgctaagcgcgatccgatggac
tttgttctatggaaaatgtctaaacctggtgaacctacttgggattctccttgggggcct
ggtcgtccaggttggcacattgaatgttcagcaatgaacagtaagcatttgggtaaccat
tttgatatccatggtggcggcagcgatcttcagttccctcaccatgagaatgagattgca
caatcttgctgtgcccatgataccaaatatgtaaattattggatgcataccggcatggtg
atggttgataaagaaaagatgtcaaaatctttgaataacttctttaccatccgagacgtg
ttaaaccactatgatgctgcaacagtacgttacttcttattgtcaggtcattaccgtagc
cagcttaattactcagaagagaaccttaagcaggctaaatctgggttagagcgtatttac
acagcgcttaaagatttggatcttacggtagatgctgcacctgctgaagcgtttatcgcc
caatttaagcgtgcaatggatgatgacttcaatacacctgaagcctactcagtgctgttt
gaaatggtacgtgaaatcaatcgtcttaaattaactgacatgcagcaagcatcagcccta
ggtgttgcgttaaagcagcttgctgatgtgttagggatcctaggtcaagatgttgatact
ttcttcaagggagaggggagtgatgatgaagtggctgagattgaagcattgattgttgaa
cgcaaccgagcacgtacagagaaagattggcctgcagctgatgtggcgcgagacggattg
aatgccttaggcgtaattcttgaagatgggccagaaggtacaacttggcgtaaaaagtaa

DBGET integrated database retrieval system