KEGG   Shewanella piezotolerans: swp_3387Help
Entry
swp_3387          CDS       T00791                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
swp  Shewanella piezotolerans
Pathway
swp00071  Fatty acid degradation
swp00072  Synthesis and degradation of ketone bodies
swp00280  Valine, leucine and isoleucine degradation
swp00310  Lysine degradation
swp00362  Benzoate degradation
swp00380  Tryptophan metabolism
swp00620  Pyruvate metabolism
swp00630  Glyoxylate and dicarboxylate metabolism
swp00640  Propanoate metabolism
swp00650  Butanoate metabolism
swp00900  Terpenoid backbone biosynthesis
swp01100  Metabolic pathways
swp01110  Biosynthesis of secondary metabolites
swp01120  Microbial metabolism in diverse environments
swp01130  Biosynthesis of antibiotics
swp01200  Carbon metabolism
swp01212  Fatty acid metabolism
swp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:swp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    swp_3387
   00630 Glyoxylate and dicarboxylate metabolism
    swp_3387
   00640 Propanoate metabolism
    swp_3387
   00650 Butanoate metabolism
    swp_3387
  09103 Lipid metabolism
   00071 Fatty acid degradation
    swp_3387
   00072 Synthesis and degradation of ketone bodies
    swp_3387
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    swp_3387
   00310 Lysine degradation
    swp_3387
   00380 Tryptophan metabolism
    swp_3387
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    swp_3387
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    swp_3387
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    swp_3387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:swp04147]
    swp_3387
Enzymes [BR:swp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     swp_3387
Exosome [BR:swp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   swp_3387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACJ30088
UniProt: B8CRT0
Position
complement(3573069..3574259)
Genome map
AA seq 396 aa AA seqDB search
MSSDLSNQDIVIVAAKRTPMGGFQGALATVASPKLAATAIKGLMQHSGLAGEQVDEVLMG
CVLPAGLGQAPARQATLGAELPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSANVVIAGG
MENMSQAPYLLDKARGGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQNTADDFNLTREQ
MDGFALSSLEKANNAIAAGAFNAEITPVTVANRRGDVVVDTDEQPGNARPDKIPTLRAAF
AKDGTITAANSSSISDGAAALMLMTRAQASELKLEVMATIKGHTTHAQEPSMFTTAPVGA
MNKLLDKVSWSKDEVDLFEINEAFAMVTMLAVSELGLDINKVNVNGGACALGHPIGCSGA
RLLVTLIHALKARGLSKGVASLCIGGGEATAMAIEL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagatctgtcaaaccaagatattgtaatagttgcagctaaacgcacacctatg
ggtggattccaaggggcgcttgcaacagtcgcttctccaaaattggcggcaactgcgatt
aaaggtctgatgcagcacagtggcttagcgggtgagcaggttgacgaagtactaatgggc
tgtgtactgccagcaggtcttggtcaagcgcctgcacgtcaagcgactcttggcgctgag
ttaccgctatcggttggtgcaaccacagtgaacaaagtttgtggttctggtatgaaaacc
gtgatgcttgcgcatgatttaattaaagcgggcagcgccaacgtggtgattgctggcggg
atggaaaacatgagccaagcgccttatctgctagataaagcccgcggcggtatgcgcatg
ggtcatggtaaagtgttagaccatatgttccttgatggactagaagatgcttacaccggc
ggtgcaatgggcacctttgcccaaaacacagctgatgattttaatttaacacgtgagcaa
atggatggctttgcgctcagttcgctagaaaaagctaacaatgctatcgcagctggcgcg
ttcaatgctgaaattacgcctgtaacagttgcaaatcgccgcggcgatgttgtggttgat
accgatgaacagccaggtaacgcccgaccagataaaatcccaacactacgagcagcattt
gccaaagatggcaccattacagctgctaactctagctctatttcagatggtgctgcagcg
ttaatgctaatgacccgcgcacaggcgagcgagcttaaattagaagtgatggctactatc
aaaggtcacactacccacgctcaagaaccttcaatgttcactactgcgccagttggtgcg
atgaataaactgttagataaagtcagttggagcaaagatgaggttgatctgtttgagatc
aacgaagcctttgccatggtgaccatgttggccgtttcagagcttggactcgacataaat
aaagtcaacgttaatggcggcgcctgtgcacttggccatccgattggctgctctggcgca
cgcttgctcgttacccttatccatgcgctaaaagcacgcggcctgtctaaaggcgtggcg
tcactgtgtattggcggcggcgaagctacagcaatggcaattgagctttaa

DBGET integrated database retrieval system