KEGG   Shewanella piezotolerans: swp_4088Help
Entry
swp_4088          CDS       T00791                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
swp  Shewanella piezotolerans
Brite
KEGG Orthology (KO) [BR:swp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    swp_4088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACJ30752
UniProt: B8CSX6
Position
4295459..4295839
Genome map
AA seq 126 aa AA seqDB search
MNQRLSPIKVEVKTEYIEAQSTPDEEKYLFSYTITIINLGDQDVTLKSRYWCITDANGQQ
SEVEGAGVVGETPTIKPNTAYQYTSGTVLETPFGVMEGNYTMIKSNGEEFKAPISAFSLA
VPGLLH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaacgcttgtccccgataaaagttgaagttaagacagaatatattgaagcgcaa
tcgacaccagatgaagagaaatatttattcagttataccatcaccataatcaatctaggt
gatcaagatgtcactttaaagagtcgctactggtgcattacagatgcaaatggacaacaa
agtgaagttgaaggtgcaggcgttgtcggtgaaactccaacgataaaacccaatacagcc
tatcagtacaccagcggaactgttctagaaactccatttggagtaatggaaggcaactac
accatgattaagagtaacggcgaagagttcaaagcaccaatatcagcatttagccttgct
gtaccaggcttacttcattaa

DBGET integrated database retrieval system