KEGG   Shewanella piezotolerans: swp_5081Help
Entry
swp_5081          CDS       T00791                                 

Definition
(GenBank) Lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
swp  Shewanella piezotolerans
Pathway
swp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:swp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    swp_5081
Enzymes [BR:swp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     swp_5081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_5 Esterase Lipase_3 PGAP1 Thioesterase
Motif
Other DBs
NCBI-ProteinID: ACJ31696
UniProt: B8CVM0
Position
5305704..5306681
Genome map
AA seq 325 aa AA seqDB search
MPNAAEPAPSLSTASSFSSEHHLNSPEQTAFWQQVTQSSFKANDDVSLAYACIINPNSIG
TIVLSSGRVESYLKYKELMFDLYLQGYSLFAIDHRGQGLSSRTTTDPHKGHIDKFQRYVD
DFGDFINKVVKPQPEEDYFLVGHSMGGAIGTLYLEQHSGVFKAAVFSAPMYGIKLPLPKR
FIRWLAARLDNHNKQQPNYVLGGKGYHADEFDKNDLTNSKLRYQDYRKLYEQEPKLQLGS
PTNHWLVESIDAGDDAIKAAQNIDIPLLVLQAEEDTIVSNTAQKKAATGQCKLLKIPYAR
HEIFMERDKARNLALSALLAFLQQT
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatgccgctgagcccgctccatcattaagcactgcaagttccttttcatcagag
catcacctcaatagcccagaacaaactgcattttggcagcaagtgactcaatcaagtttc
aaagcaaatgatgatgtcagcctggcttatgcctgcatcatcaatccaaatagcatagga
acaattgtactcagtagcggccgagttgagtcctatttgaagtataaagagttgatgttt
gatctgtacctgcaaggttacagtttatttgccattgaccatcgtggacagggcctttcc
agcagaacaaccacagatccacataaaggacatatcgacaaattccagcgttatgtcgac
gattttggcgattttatcaacaaagttgtaaagccacagccagaagaagattactttcta
gtaggacattccatgggaggcgcaattggtactttatacctagagcagcattcaggagtg
tttaaagccgccgttttttctgcacctatgtatggcattaaactacctttgcctaaacgc
tttattcgttggttagcagcacgactcgataatcataacaaacagcaaccaaattatgta
ttgggtggcaaaggttaccatgcagatgagttcgacaagaacgatctcaccaacagtaaa
ctgcgttaccaagattatcgcaaactctatgagcaagagcccaagttacagctaggttcg
ccgactaatcattggctggtagagtcaatcgacgccggcgatgatgccattaaggccgca
cagaatattgatattcccttgctagtattgcaagctgaagaagacactattgtcagtaat
accgctcaaaaaaaagcggctacaggtcaatgcaagctgctcaaaattccctatgctcgc
catgaaatattcatggagcgcgataaggccagaaacctagccctaagcgcactgctggca
tttttacagcaaacttaa

DBGET integrated database retrieval system