KEGG   Streptomyces xiamenensis: SXIM_15070Help
Entry
SXIM_15070        CDS       T03904                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SXIM_15070
Enzymes [BR:sxi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SXIM_15070
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SXIM_15070
    1.1.1.-  
     SXIM_15070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C YdfZ 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AKG42891
UniProt: A0A0F7CNG9
Position
complement(1609877..1610953)
Genome map
AA seq 358 aa AA seqDB search
MRHLDRRNTSVMNAEQRYVRVSGPRQLEELAGDEQRPAPDGVVVDITYSGICGTDVHGYT
DGHMLPPAVFGHEWTGTVRAIGDEVSHVRVGQRVIGGVGPACGACRQCLAGHYRQCDTAF
AEANGVDEAAPAHGAFATRVRVSARRVIPVPEGISDVEAALVEPATVTFHAVRRTALEPG
SVVVVQGAGPIGLLTAQHARNAGAGQVIVSEPSPARRNAAEKLGFSEVVAPQDLPGLLSE
ATGGLGADVLFECAGVASLLQPSAELVRRGGVLALLGFPLTESTVSYGDWQSRELTVIGS
LAYNHEDFMGTMRAITQKRIDVASLHTGTVGLSQLGDMLEELDSGKSAHAKVLVDPRA
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcacctggaccgaaggaacacgagtgtcatgaatgcagaacagcgctatgtgagg
gtgtcggggccgcggcagttggaggagttggccggggacgagcagcgacccgcgccggac
ggcgtggtcgttgacatcacgtacagcgggatctgcgggacggatgtccacggatacacc
gacgggcacatgctgccgcccgccgttttcggtcacgagtggacggggaccgtccgcgcg
atcggggacgaggtgtcccacgtgcgggtcggccagcgcgtgatcggcggcgtcgggccc
gcctgcggtgcgtgtcggcagtgcctggccggtcactataggcagtgcgacacggcgttt
gccgaggccaacggcgtggacgaggccgctcccgcccacggggccttcgcgacgcgcgtc
cgggtgtcggcgcgtcgggtgatccccgtgcccgagggcatctcggatgtcgaagccgca
ctggtggagccggcgaccgtgaccttccacgcggtgcggcgcaccgcactggagcccggg
tccgtggtcgtggtgcagggcgcggggccgatcggcctgctcaccgcccagcacgcgcgc
aacgcgggcgccggccaggtcatcgtctcggaaccctcgccggcccgccggaacgccgct
gagaagctgggcttcagtgaggtggtggcgccccaggacctgcctggtctcctctcggag
gccaccggcggactcggggccgacgtgttgttcgagtgcgcgggtgtcgcgtccctgttg
cagccgtccgccgagctggtccggcgcggcggagtcctcgcgctgctcggcttccccctg
accgagtcgacggtcagttacggggactggcagagcagggaactgacggtcatcggctcg
ctcgcctacaaccacgaggatttcatgggaacgatgcgcgccatcacccagaagcggatc
gatgtcgcctccctgcacaccggcaccgtcggcctgtcacagctcggcgacatgctggag
gagctcgactcgggcaagagtgctcacgccaaggtgctggtcgatccgcgcgcctga

DBGET integrated database retrieval system