KEGG   Streptomyces xiamenensis: SXIM_30650Help
Entry
SXIM_30650        CDS       T03904                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sxi  Streptomyces xiamenensis
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SXIM_30650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AKG44449
UniProt: A0A0F7FVH8
Position
complement(3327086..3328084)
Genome map
AA seq 332 aa AA seqDB search
MDTFALLVVIGAALFFTYTNGFHDSANAIATSISTRALTPRVALGMAAVMNLAGAFLGSG
VAKTVSEGLIDTPTGKQGMIILFAGLLGAITWNMISWYFGLPSSSSHALFGGLVGAALAG
ASTVHWDGVLSKIVIPMFVSPLIGLLLGYLVMVAILWLFRRANPHRAQRGFRIAQTVSAA
GMALGHGLQDAQKTMGVVFMALVIADVEPEGGAIPVWVKIACAGMLSLGTYAGGWRIMRT
LGRRIIELDPPRGFAAETTAASVLYSASYIFNAPISTTHVITSAIMGAGATKRVSAVRWG
VAKSIVKGWFITMPAAGAVAAITYWVIHLFFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgttcgcccttctcgtcgtcatcggtgcggcgctcttcttcacctacaccaac
ggcttccacgactcggcgaacgccatcgccacctccatctccacccgggcgctgaccccg
cgggtcgcgctgggcatggccgccgtgatgaacctggccggcgccttcctcggcagcggc
gtcgccaagacggtgagcgaagggctgatcgacacccccaccggcaaacaaggcatgatc
atcttgttcgccgggctgctcggggcgatcacctggaacatgatctcctggtatttcggc
ctcccctcgtcctcctcgcacgccctgttcggcggcctggtcggggcggcgctggccgga
gcgagcaccgtccactgggacggtgtgctctccaagatcgtcatcccgatgttcgtctcg
cccctcatcggcctgctgctgggctatctggtgatggtggccatcctgtggctgttccgg
cgcgccaacccgcaccgggcccagcgcggcttccggatagcgcagaccgtctcggccgcc
ggcatggcgctcgggcacggactccaggacgcgcagaagaccatgggcgtggtcttcatg
gcgctggtcatcgccgacgtggaaccggagggcggcgccatcccggtgtgggtgaagatc
gcctgcgccggaatgctgtcgctgggcacgtacgcggggggctggcgcatcatgcgcacg
ctgggccgccggatcatcgagctggacccgccgcgcgggttcgccgccgagaccaccgcc
gcctccgtgctgtactccgcctcgtacatcttcaacgccccgatctccaccacccacgtg
atcacctcggcgatcatgggcgcgggggccaccaagcgggtcagcgcggtgcgctggggc
gtggccaagtcgatcgtcaagggatggttcatcacgatgccggcggccggcgccgtggcg
gcgatcacgtactgggtgatccacctcttcttcggctga

DBGET integrated database retrieval system