KEGG   Streptomyces xiamenensis: SXIM_39610Help
Entry
SXIM_39610        CDS       T03904                                 

Definition
(GenBank) cellulose 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00500  Starch and sucrose metabolism
sxi01100  Metabolic pathways
sxi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SXIM_39610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SXIM_39610
Enzymes [BR:sxi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SXIM_39610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AKG45345
UniProt: A0A0F7FXD3
Position
complement(4212583..4213986)
Genome map
AA seq 467 aa AA seqDB search
MNPPHEHPPHRRGRRIALAAGALLGAGALTVGTLGAASANEEPSTLDRVDNPYVGAGVYV
NPEWSANAAAEPGGSQIADQPTGVWLDRTAAIEGDGQGGGRTMGLRDHLDTAVEQAAGSD
AFVFQVVVYNLPGRDCSALASNGELGPTEIDRYKSEFIDPIAEILADPAYADLRIVTTIE
IDSLPNLVTNVTPRPTATPECDVMKANGNYVEGVAYALDQLGAIPNVYNYIDAGHYGWIG
WDDNFTASAELFKTAATTGGATVDDVHGFIVNTANFGPAVEPYYSISDSINGASVRESKW
VDWNRYVDNQGFAQAFRTELVRQGFNSGIGMLIDTSRSGWGGSDRPSGPGPRTSLDAFVE
GSRVDGRIHQGNWCNQAGAGLGERPTAAPATGIDAYVWMKPPGESDGSSTEIPNDEGKGF
DRMCDPTYEGNPRNNNNMSGALPDAPVSGHWFSAQFQELLANAYPPL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccccgcacgagcatccgccgcaccgccgcggacgccggatcgccctggcggcg
ggcgcccttctcggcgccggcgcactgaccgtcggcaccctgggtgccgcctcggccaac
gaggagcccagcactctggaccgggtggacaacccgtatgtcggtgctggtgtgtatgtg
aatccggagtggtcggccaacgccgccgccgaaccgggtggcagtcagatcgcggatcag
ccgacgggtgtgtggctggaccggacggctgcgatcgagggtgatggtcagggcgggggc
cgcacgatgggtctgcgcgaccacctcgatacggcggtggagcaggcggccgggagcgac
gcgttcgtcttccaggtcgtcgtctacaacctgccgggccgtgactgttcggctctggcg
tccaacggtgagctgggcccgaccgagatcgaccggtacaagtccgagttcatcgatccg
atcgcggagatcctcgccgatccggcctacgcggatctgcggatcgtgacgacgatcgag
atcgactcgctgcccaacctcgtcaccaacgtcaccccgcggcccacggccacccccgag
tgcgacgtgatgaaggccaacggcaactatgtcgagggcgtggcctatgcccttgaccag
ctcggtgccatcccgaacgtctacaactacattgacgccgggcactacggctggatcggc
tgggacgacaacttcaccgcctccgccgagctgttcaagacggccgccaccaccggcggc
gccaccgtcgacgacgtccacggcttcatcgtcaacacggccaacttcgggccggcggtc
gagccgtactactccatcagtgactccatcaacggcgcctcggtccgtgagtcgaagtgg
gtcgactggaaccgctacgtcgacaaccagggcttcgcccaggccttccgcaccgagctg
gtccggcagggcttcaactccggcatcggcatgctgatcgacacctcccgcagcggctgg
ggcggctccgaccggccctccggccccggtccgcgcaccagcctggacgccttcgtcgag
ggcagccgcgtcgatggccgtatccaccagggcaactggtgcaaccaggccggcgccggc
ctcggtgagcgcccgaccgccgctcccgccaccgggatcgacgcgtacgtgtggatgaag
cccccgggcgagtccgacggctcgagcaccgagatcccgaacgacgagggcaagggcttc
gaccgcatgtgcgacccgacctacgagggcaacccccgcaacaacaacaacatgtccggt
gccctgccggacgccccggtctccggacactggttctccgcccagttccaggagctcctg
gcgaacgcctacccgcccctgtga

DBGET integrated database retrieval system