KEGG   Streptomyces xiamenensis: SXIM_50550Help
Entry
SXIM_50550        CDS       T03904                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sxi  Streptomyces xiamenensis
Pathway
sxi00450  Selenocompound metabolism
sxi00970  Aminoacyl-tRNA biosynthesis
sxi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sxi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SXIM_50550
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SXIM_50550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sxi01007]
    SXIM_50550
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sxi03016]
    SXIM_50550
Enzymes [BR:sxi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SXIM_50550
Amino acid related enzymes [BR:sxi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SXIM_50550
Transfer RNA biogenesis [BR:sxi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SXIM_50550
 Prokaryotic type
   Other AARSs
    SXIM_50550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: AKG46439
UniProt: A0A0F7FZY0
Position
complement(5448485..5450221)
Genome map
AA seq 578 aa AA seqDB search
MTRHLITSALPYINGIKHLGNMVGSMLPADVYSRYLRQRGHEVLYICATDEHGTPAELAA
KTAGLPVAEFCARQHDAQKAVYDGFGLSFDYFGRTSSAQNIEITQHFARQLKANGFIEER
STRQVYSLADERFLPDRYIVGTCPFCGYEAARGDQCENCTRVLDPTDLLDPRSAVSGSTE
LEIRETTHLFLLQSKLEGEVEAFVDEAGKEWPVLASSIARKWLTEGLHDRAITRDLEWGV
PVPADVWPELAAEGKVFYVWFDAPIGYIGATKEWADAAGDGESRDWRSWWFGTGTGADEG
GSVRYTEFMAKDNVPFHTVMFPATELGTREPWKKVDYVKAFNWLTYYGGKFSTSQNRGIF
VDDALELLPADYWRYFLMASAPESDDASFSWEHFSAIVNKDLADTLGNFVNRVLTFSRKR
FGDEVPAGHAAGEAEARLGAEVARLLAEYEEHLEALQFRKATFALRALWSAGNSYLEEKA
PWLEIKSDPEAAALTLRTAMNLIQLYAVVSEPVIPASAAVLRSVFGVADAGGWVTPEQAT
ALDTITAGTAFTVPPVLFAKITEDDLAGYRERFGGAEE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgacccgacacctcatcaccagtgcgctgccgtacatcaacgggatcaagcacctgggg
aacatggtcggctcgatgctcccggcggatgtgtactcccgctatctgcggcagcggggc
cacgaggtgctgtacatctgcgccaccgacgagcacggcaccccggcggagctggccgcc
aagacggcggggctgccggtggccgagttctgtgcccgccagcacgacgcgcagaaggcg
gtgtacgacggtttcggtctgtccttcgactacttcggccgtacctcctcggcgcagaac
atcgagatcacccagcatttcgcgcggcagctgaaggccaacggcttcatcgaggagcgc
tccacccgccaggtgtactcgctggcggacgagcggttcctgcccgaccgctacatcgtg
ggcacctgcccgttctgcggttacgaggcggcccgcggcgaccagtgcgagaactgcacc
cgggtgctggaccccaccgatctgctcgacccgcgctcggcggtctccggcagcaccgag
ctggaaatccgtgagaccacgcatctgttcctgctccagtcgaagctggagggcgaggtc
gaggcgttcgtcgacgaggcgggcaaggagtggccggtgctggcctcctccatcgcccgc
aagtggctgaccgaggggctgcacgaccgggcgatcacccgtgacctggagtggggggtg
ccggtgccggccgatgtgtggccggagctggccgccgagggcaaggtcttctacgtctgg
ttcgacgcgccgatcggctacatcggtgccaccaaggagtgggcggacgcggccggggac
ggcgagagccgcgactggcgctcgtggtggttcggcacgggtacgggcgcggacgagggc
ggctcggtgcggtacaccgagttcatggcgaaggacaacgtgcccttccacacggtgatg
ttcccggccaccgagctgggcacccgggagccgtggaagaaggtcgactacgtcaaggcg
ttcaactggctgacgtactacggcggcaagttctccacctcgcagaaccgcggcatcttc
gtcgacgacgcgctggagctgctgcccgccgactactggcggtacttcctgatggcgagc
gcccccgagtcggacgacgcctcgttctcctgggagcacttctccgcgatcgtcaacaag
gacctggcggacaccctgggcaacttcgtcaaccgcgtgctgacgttctcgcgcaagcgg
ttcggtgacgaggtgccggccgggcacgcggccggtgaggccgaggcccgcctgggcgcg
gaggtggcgcggctgctggccgagtacgaggagcacctggaggcgctccagttccgcaag
gcgaccttcgcgctgcgcgccctgtggagcgcgggcaactcctacctggaggagaaggcc
ccctggctggagatcaagagcgacccggaggcggcggcgctgacgctgcgcaccgcgatg
aacctgatccagctgtacgcggtggtctccgagccggtcatcccggcctcggccgccgtg
ctgcgctcggtgttcggtgtcgcggacgccggtggctgggtgacgcccgagcaggccacc
gccctggacacgatcacggcgggcaccgcgttcacggtgcccccggtgctgttcgccaag
atcaccgaggacgatctggcgggctaccgggagcgcttcggcggcgccgaggagtaa

DBGET integrated database retrieval system