KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0291Help
Entry
SXYLSMQ121_0291   CDS       T03311                                 

Definition
(GenBank) Urease beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl00220  Arginine biosynthesis
sxl00230  Purine metabolism
sxl01100  Metabolic pathways
sxl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SXYLSMQ121_0291
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SXYLSMQ121_0291
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SXYLSMQ121_0291
Enzymes [BR:sxl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SXYLSMQ121_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta PapD_N
Motif
Other DBs
NCBI-ProteinID: AID41723
UniProt: A0A518P5I0
Position
complement(357404..357817)
Genome map
AA seq 137 aa AA seqDB search
MKPGEIIVKRTEIEVNRGHNATILDVKNTGDRPIQVGSHYHFFEANPALQFEREKAYGKR
LDIPAGAAVRFEPGDEKEVQLVEYSGKRRIFGFHGEVNGPIDEARVYKAEDDDSATEIIA
EENKVSENANKESGYNR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctggcgaaattatagttaaacgtacagaaattgaagttaatcgtggacacaac
gctacgatactcgatgtaaaaaacacaggagatcgccctattcaagtaggttctcattat
catttttttgaagcgaatcccgccttacaatttgaacgagaaaaagcttatgggaaacgt
ttagacatccctgctggtgccgcagtgcgttttgaacctggtgacgaaaaagaagttcag
ctcgttgaatatagcggtaaaagaagaatttttggtttccatggtgaagtgaatggacct
attgacgaggcgcgtgtttataaggctgaagatgacgacagcgctacagaaattatagct
gaagaaaataaagtcagcgaaaatgctaataaagaaagtgggtataacagatga

DBGET integrated database retrieval system