KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0356Help
Entry
SXYLSMQ121_0356   CDS       T03311                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase, Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl00071  Fatty acid degradation
sxl00072  Synthesis and degradation of ketone bodies
sxl00280  Valine, leucine and isoleucine degradation
sxl00310  Lysine degradation
sxl00362  Benzoate degradation
sxl00380  Tryptophan metabolism
sxl00620  Pyruvate metabolism
sxl00630  Glyoxylate and dicarboxylate metabolism
sxl00640  Propanoate metabolism
sxl00650  Butanoate metabolism
sxl00900  Terpenoid backbone biosynthesis
sxl01100  Metabolic pathways
sxl01110  Biosynthesis of secondary metabolites
sxl01120  Microbial metabolism in diverse environments
sxl01130  Biosynthesis of antibiotics
sxl01200  Carbon metabolism
sxl01212  Fatty acid metabolism
sxl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SXYLSMQ121_0356
   00630 Glyoxylate and dicarboxylate metabolism
    SXYLSMQ121_0356
   00640 Propanoate metabolism
    SXYLSMQ121_0356
   00650 Butanoate metabolism
    SXYLSMQ121_0356
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SXYLSMQ121_0356
   00072 Synthesis and degradation of ketone bodies
    SXYLSMQ121_0356
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SXYLSMQ121_0356
   00310 Lysine degradation
    SXYLSMQ121_0356
   00380 Tryptophan metabolism
    SXYLSMQ121_0356
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SXYLSMQ121_0356
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SXYLSMQ121_0356
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SXYLSMQ121_0356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sxl04147]
    SXYLSMQ121_0356
Enzymes [BR:sxl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SXYLSMQ121_0356
Exosome [BR:sxl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SXYLSMQ121_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HTH_7
Motif
Other DBs
NCBI-ProteinID: AID41788
Position
426331..427485
Genome map
AA seq 384 aa AA seqDB search
MNKVAIVSAKRTPIGRFRGKLSKYSAVELGTKTLEAAMKAINIDPQKVEQVIYGNVLQSG
SGQNPARQIAIHSGVPNTTPAMTINEVCGSGLKSIILGKQLIQLGEAKVVAVGGVESMTN
APKLVLNEGESPVDSFMHDGLTDAFLNVPMGITAEKIAEKYNVSREAQDYFANESQQKAQ
QATEAGKFNNEIVPLEDVNGEMMTTDEGIRGNSSVEKLSTLKTIFKEDGTVTGGNASSIN
DGASTIILMDADYAKQEGYEILAIVGEHAEIGCDPEYMGYAPYHAVTKLLDKTDKVIDDF
DVVEMTEAFASQSIPVRDNLSISEDKLNLYGGAIALGHPIGASGTRLVTTLVNILAQEEK
QSGIATACIGGGLGIAIQIEKENN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtagcaatcgtaagtgcaaaacgtacaccaataggaagatttagagggaaa
ttaagtaaatattcagcagttgaacttggaacgaagacattagaagctgctatgaaggca
attaacatagatccacagaaagtagagcaagttatctatggtaatgtattacaaagcggt
agtggtcaaaatcctgcccgtcaaatagcaatccattccggtgttccaaatacaacacca
gctatgaccataaatgaagtgtgtggctctggcttaaaatctattattttaggaaagcaa
ttaatccaattaggtgaagctaaagtagtggctgtaggtggtgtggaaagcatgacaaat
gcacctaagttagtgcttaatgaaggtgaatctcctgtagatagctttatgcacgatggt
cttactgacgcttttttaaacgtacctatgggtattacagctgaaaaaattgcagaaaag
tacaacgtatcacgtgaagcacaggattattttgctaacgaatctcaacaaaaagcacaa
caagcgacagaagcaggtaaatttaataatgaaatcgttccattagaagatgtaaatgga
gaaatgatgactacggatgaaggtattcgtggaaatagtagtgttgagaaattaagtaca
ttaaaaacaatatttaaagaagacggcacggtaacaggcggcaacgcgtctagtattaat
gatggtgcgtctacaattattttaatggatgctgactatgcgaaacaagaaggctatgaa
attttagctatagttggagagcatgccgaaattggttgtgatccggagtatatgggctat
gcaccatatcatgcagtgacaaaattattagataagacagataaggtcatcgatgacttt
gatgtagtagaaatgacggaagcttttgcgtcacaaagtattcctgtgagagacaattta
agtatatctgaagataagctgaatttatatggtggtgcgattgcgttaggtcaccctata
ggcgcaagtggtacacgcttagttacaactttagttaatattttagctcaagaagagaaa
caatcaggtatagcaactgcttgtatcggtggcggtttaggaattgcaatccaaattgaa
aaggagaataactaa

DBGET integrated database retrieval system