KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0574Help
Entry
SXYLSMQ121_0574   CDS       T03311                                 

Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl00020  Citrate cycle (TCA cycle)
sxl00620  Pyruvate metabolism
sxl01100  Metabolic pathways
sxl01110  Biosynthesis of secondary metabolites
sxl01120  Microbial metabolism in diverse environments
sxl01130  Biosynthesis of antibiotics
sxl01200  Carbon metabolism
Module
sxl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sxl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SXYLSMQ121_0574
   00620 Pyruvate metabolism
    SXYLSMQ121_0574
Enzymes [BR:sxl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     SXYLSMQ121_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase Pyr_redox_2 HI0933_like FAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AID42006
Position
663664..665142
Genome map
AA seq 492 aa AA seqDB search
MSTQHSKTDVILIGGGIMSATLGTLLKELAPEKEIKMFERLATPAEESSNAWNNAGTGHS
ALCELNYTSENKDGTIDINKAVKINEQFQVSKQFWSYLIKKGQLENPEKFIKPVPHMSFV
QGVKNVDFLKRRVDRLNKNILFSNMEITDDKDKIAEWTPLIMEGRTSNIPMAISYDKTGT
DVNFSGLTRKLFENLEDKQVELNYEHEVRDIQQRKDGVWEVKVKDLQTNDETIVESDFVF
IGAGGASLQLLQKTGIKESKHIGGFPVSGLFLVCKDEAIAKKHLAKVYGKAPVGAPPMSV
PHLDTRYIDGKRTILFGPFAGFSPKFLKTGSNMDLIKSVKPNNLITMLSAGIKEMNLTKY
LISQLTLSNEERMEDLRQFVPNAKSEDWEIVVAGQRVQVIKDTDQGKGTLQFGTEVITSE
DGSLSALLGASPGASTAVDIMLDLLKRCYKDEFVNWEDKVKEIIPSYGMKLSENEALYTQ
LNKEITENLKIN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacaacatagcaaaacagatgtcatcttaattggtggcggtatcatgagcgca
acgttaggaacattattaaaagaactcgcacctgagaaagaaattaagatgtttgaaagg
ttagctacacctgcggaagaaagttccaatgcatggaataatgcaggtacaggtcattct
gcgttatgtgaattaaactatactagtgaaaataaagatggaacaatagatatcaataaa
gcggttaaaattaatgaacaattccaagtttcaaaacaattttggagttatctgattaaa
aaaggacaacttgaaaatccagaaaaatttatcaaaccagtaccacatatgagctttgtt
caaggtgttaaaaatgttgatttcttgaaaagacgtgtagacagactaaacaaaaacatt
ttattcagtaatatggaaatcacagatgataaagataaaatcgctgaatggacaccactt
attatggagggccgtacgtccaatataccaatggcgattagttatgataaaacaggaaca
gacgttaacttcagtggattaactagaaagttattcgaaaatttagaagataagcaagta
gagttaaattatgaacatgaagtaagagatattcagcaacgtaaagatggcgtgtgggaa
gtgaaagttaaagacttgcaaacgaacgatgagacgattgttgaaagtgactttgtattt
attggcgctggtggcgctagtttacagttgttgcaaaaaacaggaattaaagagtctaaa
catataggtggtttcccagtaagtggattgttcttagtatgtaaagatgaagctattgcc
aaaaagcatttagctaaagtttatggtaaagctccagtaggtgctccaccaatgtcagta
ccacatttagatacacgctatatagatggcaaacgaactattttatttggtccatttgca
ggtttttcaccaaaattcttaaaaacgggttctaatatggatttaatcaagtctgttaag
ccaaataaccttattacgatgttatctgcaggaattaaagagatgaatttaacgaaatat
cttatctcgcaattaacgttatcaaatgaagaacgtatggaagatttacgtcaatttgta
cctaatgctaaaagcgaagattgggaaatcgtcgttgctggtcaacgtgtgcaagtaatt
aaggatacggatcaaggtaaaggaacattacaatttggtacggaagttattacgtcagaa
gatggttcattatctgcacttttaggtgcttctccaggtgcgtctacggcagtcgacatt
atgcttgatttgctcaagcgttgttacaaagacgaattcgttaattgggaagataaagtc
aaagaaatcataccttcgtatggcatgaaactatcagaaaatgaagcgttatatactcaa
ttaaataaagaaataacggaaaatttaaaaattaattaa

DBGET integrated database retrieval system