KEGG   Staphylococcus xylosus SMQ-121: SXYLSMQ121_0700Help
Entry
SXYLSMQ121_0700   CDS       T03311                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
sxl  Staphylococcus xylosus SMQ-121
Pathway
sxl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sxl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SXYLSMQ121_0700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sxl03011]
    SXYLSMQ121_0700
Ribosome [BR:sxl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SXYLSMQ121_0700
  Bacteria
    SXYLSMQ121_0700
  Archaea
    SXYLSMQ121_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: AID42132
UniProt: A0A060MQJ0
Position
791323..791676
Genome map
AA seq 117 aa AA seqDB search
MEAKAVAKTIRIAPRKVRLVLDLIRGKNAGEAIAILKLKNKASSPVVEKLLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctaaaacaataagaatcgcacctcgtaaagttagattagta
ttagatctaataagaggcaaaaatgctggagaagctattgcgattttaaaattaaagaac
aaagcttcatcaccagtagttgaaaaattattaatgtccgctttagcaaatgctgaacat
aactacgacatgaacacagatgaattagtagttaaagaagcttatgctaatgaaggacca
acattaaaacgtttccgtccacgtgcacaaggccgtgcaagtgcgatcaacaaacgtaca
agccatattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system