KEGG   Staphylococcus xylosus C2a: SXYL_00295Help
Entry
SXYL_00295        CDS       T03742                                 

Gene name
ureB
Definition
(GenBank) Urease subunit beta
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo00220  Arginine biosynthesis
sxo00230  Purine metabolism
sxo01100  Metabolic pathways
sxo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SXYL_00295 (ureB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SXYL_00295 (ureB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SXYL_00295 (ureB)
Enzymes [BR:sxo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SXYL_00295 (ureB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Urease_beta PapD_N
Motif
Other DBs
NCBI-ProteinID: CEF17722
UniProt: A0A518P5I0
Position
Chr1:complement(339234..339647)
Genome map
AA seq 137 aa AA seqDB search
MKPGEIIVKRTEIEVNRGHNATILDVKNTGDRPIQVGSHYHFFEANPALQFEREKAYGKR
LDIPAGAAVRFEPGDEKEVQLVEYSGKRRIFGFHGEVNGPIDEARVYKAEDDDSATEIIA
EENKVSENANKESGYNR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctggcgaaattatagttaaacgtacagaaattgaagttaatcgtggacacaac
gctacgatactcgatgtaaaaaacacaggagatcgccctattcaagtaggttctcattat
catttttttgaagcgaatcccgccttacaatttgaacgagaaaaagcttatgggaaacgt
ttagacatccctgctggtgccgcagtgcgttttgaacctggtgacgaaaaagaagttcag
ctcgttgaatatagcggtaaaagaagaatttttggtttccatggtgaagtgaatggacct
atcgacgaggcgcgtgtttataaggctgaagatgacgacagcgctacagaaattatagct
gaagaaaataaagtcagcgaaaatgctaataaagaaagtgggtataacagatga

DBGET integrated database retrieval system