KEGG   Staphylococcus xylosus C2a: SXYL_00710Help
Entry
SXYL_00710        CDS       T03742                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
sxo  Staphylococcus xylosus C2a
Pathway
sxo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sxo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SXYL_00710 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sxo03011]
    SXYL_00710 (rplV)
Ribosome [BR:sxo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SXYL_00710 (rplV)
  Bacteria
    SXYL_00710 (rplV)
  Archaea
    SXYL_00710 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: CEF18137
UniProt: A0A060MQJ0
Position
Chr1:776446..776799
Genome map
AA seq 117 aa AA seqDB search
MEAKAVAKTIRIAPRKVRLVLDLIRGKNAGEAIAILKLKNKASSPVVEKLLMSALANAEH
NYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVSDGKEEAKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgctaaaacaataagaatcgcacctcgtaaagttagattagta
ttagatctaataagaggcaaaaatgctggagaagctattgcgattttaaaattaaagaac
aaagcttcatcaccagtagttgaaaaattattaatgtccgctttagcaaatgctgaacat
aactacgacatgaacacagatgaattagtagttaaagaagcttatgctaatgaaggacca
acattaaaacgtttccgtccacgtgcacaaggccgtgcaagtgcgatcaacaaacgtaca
agccatattacaatcgtcgtaagtgacggtaaagaagaagctaaagaagcttaa

DBGET integrated database retrieval system